DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and ucp1

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_955817.1 Gene:ucp1 / 83908 ZFINID:ZDB-GENE-010503-1 Length:309 Species:Danio rerio


Alignment Length:291 Identity:92/291 - (31%)
Similarity:143/291 - (49%) Gaps:16/291 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IKFLFGGLSGMGATMVVQPLDLVKTRMQISG----AGSGKK-EYRSSLHCIQTIVSKEGPLALYQ 78
            :|.|..|.:...|.:|..|||..|.|:||.|    .|:.|. .|:.....|.|::..|||.:||.
Zfish    15 VKVLSAGTAACIADLVTFPLDTAKVRLQIQGEKAVTGAAKGIRYKGVFGTISTMMRTEGPRSLYN 79

  Fly    79 GIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRM 143
            |:.|.|.||..:.:.|:|:|..:.. |..:.:.:|.:...:..|...||....:..|.:|..||.
Zfish    80 GLVAGLQRQMAFASIRIGLYDNVKS-FYTRGK
DNPNVAVRILAGCTTGAMAVSMAQPTDVVKVRF 143

  Fly   144 TSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFK-TYFRH 207
            .:...|....|| |.....|..:|.:.|||..||:|:||.:.|..:||.|:|.||...| ...:|
Zfish   144 QAQMNLQGVGRR-YNGTMQAYRQIFQLEGLRGLWKGTLPNITRNALVNCTELVSYDLIKEAILKH 207

  Fly   208 GPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKP-EYRGTADVLLRVARQEG 271
            ..|  .:.:..||.::..:|.:||:.:.|:|:.|||..|     ..| :|..:.:....:..:||
Zfish   208 RLL--SDNLPCHFVSAFGAGFITTVIASPVDVVKTRYMN-----SPPGQYSSSTNCAWTMLTKEG 265

  Fly   272 VFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
            ..|.:|||.|.:.|||...|:.|:..|||.:
Zfish   266 PTAFYKGFVPSFLRLGSWNVVMFVSFEQLKR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 32/94 (34%)
Mito_carr 118..207 CDD:278578 29/89 (33%)
Mito_carr 219..307 CDD:278578 28/85 (33%)
ucp1NP_955817.1 Mito_carr 10..110 CDD:395101 32/95 (34%)
Mito_carr 111..208 CDD:395101 30/97 (31%)
Mito_carr 213..299 CDD:395101 28/89 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.