DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and UCP3

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_172866.1 Gene:UCP3 / 837973 AraportID:AT1G14140 Length:305 Species:Arabidopsis thaliana


Alignment Length:300 Identity:106/300 - (35%)
Similarity:158/300 - (52%) Gaps:19/300 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QEAPKKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYR-SSLHCIQTIVSK 70
            :|||      ...:.|...||.|.|..|..|:||.|||||:.|:||....:| .:...:..|..|
plant     8 REAP------TGTRILLASLSAMVAESVTFPIDLTKTRMQLHGSGSASGAHRIGAFGVVSEIARK 66

  Fly    71 EGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLF-REKFQRS---PGITDSMAMGTIAGACGAF 131
            ||.:.||:|:..|::|...||..|:..|..|..|. |.:...|   |..|.:: :|..:|.....
plant    67 EGVIGLYKGLSPAIIRHLFYTPIRIIGYENLKGLIVRSETNNSESLPLATKAL-VGGFSGVIAQV 130

  Fly   132 IGTPAEVALVRMTSDGRLPVAE--RRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQ 194
            :.:||::..|||.:|||| |::  :..|:....|..:|.:.||:..||:|.||.:.||.:|||.:
plant   131 VASPADLVKVRMQADGRL-VSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLPNIQRAFLVNMGE 194

  Fly   195 LASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGT 259
            ||.|...| :|.......|:.|..|..||::|||.:|..|.|.|:.|||:.|.   .....||.:
plant   195 LACYDHAK-HFVIDKKIAEDNIFAHTLASIMSGLASTSLSCPADVVKTRMMNQ---GENAVYRNS 255

  Fly   260 ADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQ 299
            .|.|::..:.||:.||||||.|.:.||||...:.::..|:
plant   256 YDCLVKTVKFEGIRALWKGFFPTWARLGPWQFVFWVSYEK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 34/94 (36%)
Mito_carr 118..207 CDD:278578 32/90 (36%)
Mito_carr 219..307 CDD:278578 32/80 (40%)
UCP3NP_172866.1 Mito_carr 9..104 CDD:395101 36/100 (36%)
Mito_carr 110..209 CDD:395101 34/101 (34%)
Mito_carr 212..299 CDD:395101 34/86 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.