DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and AT5G19760

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_197477.1 Gene:AT5G19760 / 832096 AraportID:AT5G19760 Length:298 Species:Arabidopsis thaliana


Alignment Length:306 Identity:125/306 - (40%)
Similarity:170/306 - (55%) Gaps:25/306 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KKA---VATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEG 72
            |||   |.|....|:.||.|||.||.|:||:|::|.|:|:   |.|     |:......::..||
plant     5 KKAPISVWTTVKPFVNGGASGMLATCVIQPIDMIKVRIQL---GQG-----SAASITTNMLKNEG 61

  Fly    73 PLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSP-GITDSMAMGTIAGACGAFIGTPA 136
            ..|.|:|:.|.|||||||||.|||.:..|.....|.....| .:......|..|||.||.:|:||
plant    62 VGAFYKGLSAGLLRQATYTTARLGSFKLLTAKAIESNDGKPLPLYQKALCGLTAGAIGACVGSPA 126

  Fly   137 EVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQF 201
            ::||:||.:|..||:|:||||||..:||.||:.:||:.|||:|..|||.|||.:||..||||.|.
plant   127 DLALIRMQADNTLPLAQRRNYTNAFHALTRISADEGVLALWKGCGPTVVRAMALNMGMLASYDQS 191

  Fly   202 KTYFR----HGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKM-VDGKPEYRGTAD 261
            ..|.|    .|.:....|      ||.:||......|:|.|..||:||.|:. ..||..|.|:.|
plant   192 AEYMRDNLGFGEMSTVVG------ASAVSGFCAAACSLPFDFVKTQIQKMQPDAQGKYPYTGSLD 250

  Fly   262 VLLRVARQEGVFALWKGFTPYYC-RLGPHTVLTFIILEQLNQGYNK 306
            ..::..::.|....:.|| |.|| |:.||.::|:|.|.|:.:...|
plant   251 CAMKTLKEGGPLKFYSGF-PVYCVRIAPHVMMTWIFLNQITKFQKK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 39/92 (42%)
Mito_carr 118..207 CDD:278578 48/92 (52%)
Mito_carr 219..307 CDD:278578 31/90 (34%)
AT5G19760NP_197477.1 Mito_carr 13..87 CDD:395101 37/81 (46%)
Mito_carr 101..199 CDD:395101 49/97 (51%)
Mito_carr 210..292 CDD:395101 30/82 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 83 1.000 Domainoid score I2884
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2637
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D892773at2759
OrthoFinder 1 1.000 - - FOG0004406
OrthoInspector 1 1.000 - - otm2939
orthoMCL 1 0.900 - - OOG6_101430
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2168
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.690

Return to query results.
Submit another query.