DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and DIC3

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_196509.1 Gene:DIC3 / 830806 AraportID:AT5G09470 Length:337 Species:Arabidopsis thaliana


Alignment Length:327 Identity:116/327 - (35%)
Similarity:168/327 - (51%) Gaps:51/327 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGK-----------------KEYR---------- 58
            ||.||::.:.|..:..||||:|.|||:.|..|..                 |.||          
plant     6 FLEGGIAAIIAGALTHPLDLIKVRMQLQGEHSFSLDQNPNPNLSLDHNLPVKPYRPVFALDSLIG 70

  Fly    59 -------------SSLHCIQT-------IVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLND 103
                         ||...:.|       ||..|||.||:.|:.|.:|||..|:..|:|:|.:|..
plant    71 SISLLPLHIHAPSSSTRSVMTPFAVGAHIVKTEGPAALFSGVSATILRQMLYSATRMGIYDFLKR 135

  Fly   104 LFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARIT 168
            .:.::...:..:...:..|.||||.|:.:|.||:||:|||.:||.||:..||||.:|.:|:.||.
plant   136 RWTDQLTGNFPLVTKITAGLIAGAVGSVVGNPADVAMVRMQADGSLPLNRRRNYKSVVDAIDRIA 200

  Fly   169 REEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTIT 233
            |:||:::|||||..||.|||:|..:|||:|...|.....|......||..|..||..:|::..:.
plant   201 RQEGVSSLWRGSWLTVNRAMIVTASQLATYDHVKEILVAGGRGTPGGIGTHVAASFAAGIVAAVA 265

  Fly   234 SMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILE 298
            |.|:|:.|||:.|.    .|..|.|..|..:::..:||..||:||..|...|.||.|::.|:.||
plant   266 SNPIDVVKTRMMNA----DKEIYGGPLDCAVKMVAEEGPMALYKGLVPTATRQGPFTMILFLTLE 326

  Fly   299 QL 300
            |:
plant   327 QV 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 38/134 (28%)
Mito_carr 118..207 CDD:278578 45/88 (51%)
Mito_carr 219..307 CDD:278578 30/82 (37%)
DIC3NP_196509.1 Mito_carr <19..139 CDD:395101 33/119 (28%)
Mito_carr 143..238 CDD:395101 45/94 (48%)
Mito_carr 251..336 CDD:395101 30/82 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I2290
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I1256
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2939
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2168
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.