DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and AT4G03115

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001329297.1 Gene:AT4G03115 / 828074 AraportID:AT4G03115 Length:346 Species:Arabidopsis thaliana


Alignment Length:284 Identity:96/284 - (33%)
Similarity:143/284 - (50%) Gaps:25/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GLSGMG---ATMVVQPLDLVKTRMQISGAGSGKKEYRSSL----HCIQTIVSKEGPLALYQGIGA 82
            |:||:.   ||.|..|||:||.|:|:...|.     |..|    .....::..||..:||.|:..
plant    71 GISGISVALATGVTHPLDVVKVRLQMQHVGQ-----RGPLIGMTGIFLQLMKNEGRRSLYLGLTP 130

  Fly    83 ALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRM-TSD 146
            ||.|...|...|||:|......|...| .|..:...:|.|..|||....:..|.||..||: .:.
plant   131 ALTRSVLYGGLRLGLYEPTKVSFDWAF-GSTNVLVKIASGAFAGAFSTALTNPVEVVKVRLQMNP 194

  Fly   147 GRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQ 211
            ..:|:||.|          .|..:||:.|||:|..|.:.||..:..:|||:|.:.|..... ...
plant   195 NAVPIAEVR----------EIVSKEGIGALWKGVGPAMVRAAALTASQLATYDEAKRILVK-RTS 248

  Fly   212 MEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFALW 276
            :|||..||.|:|:::||::|:.:.|:|:.|||:...:..:....||.......:|.|:||..||:
plant   249 LEEGFHLHLCSSVVAGLVSTLITAPMDMIKTRLMLQQGSESTKTYRNGFHCGYKVVRKEGPLALY 313

  Fly   277 KGFTPYYCRLGPHTVLTFIILEQL 300
            ||....:.||||.|::|||:.|:|
plant   314 KGGFAIFARLGPQTMITFILCEKL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 30/90 (33%)
Mito_carr 118..207 CDD:278578 29/89 (33%)
Mito_carr 219..307 CDD:278578 31/82 (38%)
AT4G03115NP_001329297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.