DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and PUMP1

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_190979.1 Gene:PUMP1 / 824578 AraportID:AT3G54110 Length:306 Species:Arabidopsis thaliana


Alignment Length:277 Identity:87/277 - (31%)
Similarity:137/277 - (49%) Gaps:15/277 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PLDLVKTRMQI-SGAGSGK---KEYRSSLHCIQTIVSKEGPLALYQGIGAALLRQATYTTGRLGM 97
            |||..|.|:|: ..|.:|.   .:||..|..:.||..:||..:|::|:...|.||..:...|:||
plant    31 PLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQCLFGGLRIGM 95

  Fly    98 YTYLNDLFREK-FQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGRLPVAERRNYTNVA 161
            |..:.:|:..| |.....::..:..|...||.|..:..|.::..||:.::|:|.....|.|:...
plant    96 YEPVKNLYVGK
DFVGDVPLSKKILAGLTTGALGIMVANPTDLVKVRLQAEGKLAAGAPRRYSGAL 160

  Fly   162 NALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLS 226
            ||.:.|.|:||:.|||.|..|.|.|..::|..:||||.|.|......| ...:.:..|..:.:.:
plant   161 NAYSTIVRQEGVRALWTGLGPNVARNAIINAAELASYDQVKETILK
IP-GFTDNVVTHILSGLGA 224

  Fly   227 GLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTV 291
            |........|:|:.|:|     |:.....|:||.|..::..:.:|..|.:|||.|.:.|||...|
plant   225 GFFAVCIGSPVDVVKSR-----MMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPNFGRLGSWNV 284

  Fly   292 LTFIILEQLNQGYNKYV 308
            :.|:.|||.    .|||
plant   285 IMFLTLEQA----KKYV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 26/76 (34%)
Mito_carr 118..207 CDD:278578 31/88 (35%)
Mito_carr 219..307 CDD:278578 25/87 (29%)
PUMP1NP_190979.1 Mito_carr 7..106 CDD:395101 25/74 (34%)
Mito_carr 110..206 CDD:395101 31/95 (33%)
Mito_carr 210..299 CDD:395101 28/97 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.