DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and UCP5

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_179836.1 Gene:UCP5 / 816783 AraportID:AT2G22500 Length:313 Species:Arabidopsis thaliana


Alignment Length:309 Identity:117/309 - (37%)
Similarity:179/309 - (57%) Gaps:25/309 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQISGAGSG-KKEYRSSLHCIQT------------------ 66
            |..||::.:.|.....||||:|.|||:.|..:. :...|.:| ..||                  
plant     6 FAEGGIASIVAGCSTHPLDLIKVRMQLQGESAPIQTNLRPAL-AFQTSTTVNAPPLRVGVIGVGS 69

  Fly    67 -IVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGA 130
             ::.:||..||:.|:.|.:|||..|:|.|:|:|..:...:.:...::..:...:..|.||||.||
plant    70 RLIREEGMRALFSGVSATVLRQTLYSTTRMGLYDIIK
GEWTDPETKTMPLMKKIGAGAIAGAIGA 134

  Fly   131 FIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQL 195
            .:|.||:||:|||.:|||||:.:||||.:|.:|:.::.|.||:|:|||||..|:.|||:|..:||
plant   135 AVGNPADVAMVRMQADGRLPLTDRRNYKSVLDAITQMIRGEGVTSLWRGSSLTINRAMLVTSSQL 199

  Fly   196 ASYSQFK-TYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDG-KPEYRG 258
            |||...| |....|.|  ::|:..|..||..:|.:.::.|.|:|:.|||:.|||:|.| .|.|:|
plant   200 ASYDSVKETILEKGLL--KDGLGTHVSASFAAGFVASVASNPVDVIKTRVMNMKVVAGVAPPYKG 262

  Fly   259 TADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKY 307
            ..|..|:..:.||:.:|:|||.|...|..|.||:.|:.|||:.:.:..|
plant   263 AVDCALKTVKAEGIMSLYKGFIPTVSRQAPFTVVLFVTLEQVKKLFKDY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 31/107 (29%)
Mito_carr 118..207 CDD:278578 47/89 (53%)
Mito_carr 219..307 CDD:278578 35/88 (40%)
UCP5NP_179836.1 Mito_carr 3..106 CDD:395101 31/100 (31%)
Mito_carr <136..213 CDD:395101 40/76 (53%)
Mito_carr 216..311 CDD:395101 36/94 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I2290
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I1256
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D892773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2939
orthoMCL 1 0.900 - - OOG6_101430
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2168
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.