DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and ucp3

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_956647.2 Gene:ucp3 / 794081 ZFINID:ZDB-GENE-040426-1317 Length:309 Species:Danio rerio


Alignment Length:298 Identity:92/298 - (30%)
Similarity:141/298 - (47%) Gaps:12/298 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PKKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISG-----AGSGKKEYRSSLHCIQTIVS 69
            |.....|.|:||...|.:...|.:|..|||..|.|:||.|     .||...:||.....|.|:|.
Zfish     6 PTDLPPTAAVKFFGAGTAACFADLVTFPLDTAKVRLQIQGESGTAPGSAVLKYRGVFGTITTMVR 70

  Fly    70 KEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGT 134
            .||..:||.|:.|.|.||.::.:.|:|:|..:...:....:.:..:|..:| |...||.......
Zfish    71 TEGARSLYNGLVAGLQRQMSFASVRIGLYDSMKQFYTRGSENASIVTRLLA-GCTTGAMAVAFAQ 134

  Fly   135 PAEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYS 199
            |.:|..||..:..|.....:| |....:|...|.|:||:..||:|.:|.:.|..:||..:|.:|.
Zfish   135 PTDVVKVRFQAQVRHTDGGKR-YNGTMDAYRTIARDEGVRGLWKGCMPNITRNAIVNCAELVTYD 198

  Fly   200 QFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLL 264
            ..|.......| |.:.:..||.|:..:|..|||.:.|:|:.|||..|    ....:|....:..|
Zfish   199 IIKDLILKYDL-MTDNLPCHFTAAFGAGFCTTIVASPVDVVKTRFMN----SSAGQYGSALNCAL 258

  Fly   265 RVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
            .:..:||..|.:|||.|.:.|||...::.|:..||:.:
Zfish   259 MMLTKEGPAAFYKGFMPSFLRLGSWNIVMFVSYEQIKR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 34/97 (35%)
Mito_carr 118..207 CDD:278578 26/88 (30%)
Mito_carr 219..307 CDD:278578 28/84 (33%)
ucp3NP_956647.2 Mito_carr 10..110 CDD:278578 34/99 (34%)
PTZ00169 14..298 CDD:240302 90/290 (31%)
Mito_carr 114..207 CDD:278578 27/94 (29%)
Mito_carr 211..301 CDD:278578 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.