DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and UCP2

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_024304442.1 Gene:UCP2 / 7351 HGNCID:12518 Length:310 Species:Homo sapiens


Alignment Length:264 Identity:83/264 - (31%)
Similarity:125/264 - (47%) Gaps:14/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 MQISGAGSG------KKEYRSSLHCIQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLND 103
            :||.|...|      ..:||..:..|.|:|..|||.:||.|:.|.|.||.::.:.|:|:|..:..
Human    42 LQIQGESQGPVRATASAQYRGVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQ 106

  Fly   104 LFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARIT 168
             |..|......|...:..|:..||....:..|.:|..||..:..|  ....|.|.:..||...|.
Human   107 -FYTKGSEHASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQAR--AGGGRRYQSTVNAYKTIA 168

  Fly   169 REEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTIT 233
            ||||...||:|:.|.|.|..:||..:|.:|...|.......| |.:.:..||.::..:|..||:.
Human   169 REEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDALLKANL-MTDDLPCHFTSAFGAGFCTTVI 232

  Fly   234 SMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILE 298
            :.|:|:.|||..|..:    .:|.......|.:.::||..|.:|||.|.:.|||...|:.|:..|
Human   233 ASPVDVVKTRYMNSAL----GQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYE 293

  Fly   299 QLNQ 302
            ||.:
Human   294 QLKR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 23/69 (33%)
Mito_carr 118..207 CDD:278578 28/88 (32%)
Mito_carr 219..307 CDD:278578 28/84 (33%)
UCP2XP_024304442.1 Mito_carr <42..112 CDD:332982 24/70 (34%)
Mito_carr 113..207 CDD:278578 29/95 (31%)
Mito_carr 218..300 CDD:278578 28/84 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.