DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and UCP1

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_068605.1 Gene:UCP1 / 7350 HGNCID:12517 Length:307 Species:Homo sapiens


Alignment Length:294 Identity:87/294 - (29%)
Similarity:145/294 - (49%) Gaps:10/294 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISG--AGSGKKEYRSSLHCIQTIVSKEGPLALYQ 78
            |..::....|::...|.::..|||..|.|:|:.|  ..|....|:..|..|..:|..||.:.||.
Human    12 TLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYS 76

  Fly    79 GIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRM 143
            |:.|.|.||.:..:.|:|:|..:.:......:.:|.:...:..|...|....|||.|.||..||:
Human    77 GLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRL 141

  Fly   144 TSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHG 208
            .:...|...:.| ||...||...|...||||.||:|:.|.:.|::::|.|:|.:|...|..|...
Human   142 QAQSHLHGIKPR-YTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKN 205

  Fly   209 PLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKP-EYRGTADVLLRVARQEGV 272
            .: :.:.:..|..:::::|...|..|.|:|:.|||     .::..| :|:...:..::|...||.
Human   206 NI-LADDVPCHLVSALIAGFCATAMSSPVDVVKTR-----FINSPPGQYKSVPNCAMKVFTNEGP 264

  Fly   273 FALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNK 306
            .|.:||..|.:.|||...|:.|:..|||.:..:|
Human   265 TAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 27/94 (29%)
Mito_carr 118..207 CDD:278578 32/88 (36%)
Mito_carr 219..307 CDD:278578 27/89 (30%)
UCP1NP_068605.1 Mito_carr 10..104 CDD:278578 27/91 (30%)
Solcar 1 11..102 27/89 (30%)
Mito_carr 111..206 CDD:278578 33/95 (35%)
Solcar 2 111..201 32/90 (36%)
Solcar 3 210..295 26/89 (29%)
Mito_carr 215..300 CDD:278578 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.