DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and Slc25a30

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_006519518.1 Gene:Slc25a30 / 67554 MGIID:1914804 Length:311 Species:Mus musculus


Alignment Length:264 Identity:84/264 - (31%)
Similarity:132/264 - (50%) Gaps:14/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISG----AGSGKKEYRSSLHCIQTIVSKEGPLA 75
            |.|...|::|||:.:.|.....|:||.|||:||.|    |...:..||..||.:..|..:||..|
Mouse     3 ALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDANFREIRYRGMLHALMRIGREEGLKA 67

  Fly    76 LYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVAL 140
            ||.||..|:||||:|.|.::|.|..|..|..|: .....:..::..|.::|...:.|..|.:|..
Mouse    68 LYSGIAPAMLRQASYGTIKIGTYQSLKRLAVER-PEDETLLVNVVCGILSGVISSAIANPTDVLK 131

  Fly   141 VRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYF 205
            :||.:.......      .:.::...|.::||...||:|...|..||.:|...:|..|...|.:.
Mouse   132 IRMQAQNSAVQG------GMIDSFMSIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHL 190

  Fly   206 RHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMV-DGK-PEYRGTADVLLRVAR 268
            ....| |.:.:..||.:|...||:..:.|.|:|:.:||:.|.:.: ||: ..|:||.|.||:|:.
Mouse   191 ILSGL-MGDTVATHFLSSFTCGLVGALASNPVDVVRTRMMNQRALRDGRCAGYKGTLDCLLQVSV 254

  Fly   269 QEGV 272
            ..|:
Mouse   255 SAGL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 40/96 (42%)
Mito_carr 118..207 CDD:278578 20/88 (23%)
Mito_carr 219..307 CDD:278578 21/56 (38%)
Slc25a30XP_006519518.1 Mito_carr 6..96 CDD:365909 37/89 (42%)
Mito_carr 105..191 CDD:365909 20/91 (22%)
Mito_carr 199..>259 CDD:365909 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.