DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and slc25a11

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001025683.1 Gene:slc25a11 / 595075 XenbaseID:XB-GENE-979673 Length:305 Species:Xenopus tropicalis


Alignment Length:307 Identity:183/307 - (59%)
Similarity:228/307 - (74%) Gaps:11/307 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EAPKKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEG 72
            ||.::..:..|:|||||||:|||||:.||||||||.|||:||.|:..|||::|.|.:.:|:..||
 Frog     3 EAGRQRTSPKAVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTKEYKTSFHAVGSILRNEG 67

  Fly    73 PLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAE 137
            ...:|.|:.|.|||||||||.|||:||.|.:.|.:.....|......|:|..|||.|||:|||||
 Frog    68 LRGIYTGLSAGLLRQATYTTTRLGIYTILFEKFTKADGTPPNFLMKAAIGMTAGATGAFVGTPAE 132

  Fly   138 VALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFK 202
            |||:|||:|||:||.:||.||||.|||.|::||||:|.||||.:||:.||:|||..|||||||.|
 Frog   133 VALIRMTADGRMPVDQRRGYTNVFNALVRMSREEGITTLWRGCVPTMARAVVVNAAQLASYSQSK 197

  Fly   203 TYFRHGPLQMEEG-----IKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADV 262
            .:.      ::.|     |..||||||:|||:||..|||:||||||||||:|:||||||:...||
 Frog   198 QFL------LDTGYFGDDILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDV 256

  Fly   263 LLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKYVL 309
            |::|.|.||.|:|||||||||.|||||||||||.|||:|:.|.|:.|
 Frog   257 LVKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKYYKKFFL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 54/92 (59%)
Mito_carr 118..207 CDD:278578 58/88 (66%)
Mito_carr 219..307 CDD:278578 64/87 (74%)
slc25a11NP_001025683.1 PTZ00169 13..296 CDD:240302 177/288 (61%)
Mito_carr 13..93 CDD:278578 50/79 (63%)
Mito_carr 107..202 CDD:278578 59/100 (59%)
Mito_carr 210..302 CDD:278578 66/91 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2637
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.