DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and slc25a10

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001017018.1 Gene:slc25a10 / 549772 XenbaseID:XB-GENE-955175 Length:286 Species:Xenopus tropicalis


Alignment Length:289 Identity:103/289 - (35%)
Similarity:148/289 - (51%) Gaps:24/289 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQ-TIVSKEGPLALYQGIGAA 83
            ::.||||:..||.....||||:|..:|.      ::|.:..:..:. :::..:|.||||.|:.|:
 Frog     8 RWYFGGLASCGAACCTHPLDLIKVHLQT------QQEVKMRMTGMAISVIRNDGFLALYNGLSAS 66

  Fly    84 LLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGR 148
            |.||.||:..|..:|....|...:..:........:.:|.:.|..|.||||||::..|||.:|.:
 Frog    67 LFRQITYSLTRFAIYETARDRLMQDNKAPLPFYQKVLLGAVGGFTGGFIGTPADMVNVRMQNDVK 131

  Fly   149 LPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFK-----TYFRHG 208
            ||...||||.:..:.:.|:.||||...|:.|:.....|..:|.:.|||.|.|.|     |.|   
 Frog   132 LPAHLRRNYAHALDGMFRVIREEGFRKLFSGATMASSRGALVTVGQLACYDQAKQLVLNTGF--- 193

  Fly   209 PLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVF 273
               :.:.|..||.||.::|...|....|||:.|||:.|     .|.||||.....|..|:. |..
 Frog   194 ---LSDNIFTHFLASSIAGGCATFLCQPLDVLKTRLMN-----AKGEYRGVVHCTLETAKL-GPL 249

  Fly   274 ALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
            |.:||..|...||.|||||||:.||||.:
 Frog   250 AFYKGLVPAGIRLIPHTVLTFVFLEQLRK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 28/89 (31%)
Mito_carr 118..207 CDD:278578 36/93 (39%)
Mito_carr 219..307 CDD:278578 38/84 (45%)
slc25a10NP_001017018.1 Mito_carr 12..89 CDD:365909 27/82 (33%)
Mito_carr 96..190 CDD:365909 34/93 (37%)
Mito_carr 197..281 CDD:365909 39/88 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.