DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and aralar1

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster


Alignment Length:303 Identity:87/303 - (28%)
Similarity:137/303 - (45%) Gaps:38/303 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VATNAIKFLFGGLSG-MGATMVVQPLDLVKTRMQISGAGS--GKKEYRSSLHCIQTIVSKEGPLA 75
            |..::.:|..|..:| :||| ||.|:||||||||...|||  |:..||:|..|.:.:|..||.:.
  Fly   351 VLESSYRFTLGSFAGAVGAT-VVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMG 414

  Fly    76 LYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMA---MGTIAGACGAFIGTPAE 137
            ||:|    ||.|.........:...:|||.|:|.....|...:.|   .|..|||.......|.|
  Fly   415 LYRG----LLPQLMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLE 475

  Fly   138 VALVRMTSDGRLPVAER-RNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQF 201
            :..:|:...|.:....: |.::        :.||.||..|::|:...:.|.:..:.....:|:..
  Fly   476 IVKIRLQVAGEIASGSKIRAWS--------VVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHT 532

  Fly   202 KTY------FRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTA 260
            |..      :.| ||.:       ..|..::|:.......|.|:.|||:|.:.. .|:..|.|..
  Fly   533 KAMMADKDGYNH-PLTL-------LAAGAIAGVPAASLVTPADVIKTRLQVVAR-SGQTTYTGVW 588

  Fly   261 DVLLRVARQEGVFALWKGFTPYYCRLGPH---TVLTFIILEQL 300
            |...::..:||..|.|||......|..|.   |::|:.:|::|
  Fly   589 DATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRL 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 38/95 (40%)
Mito_carr 118..207 CDD:278578 19/98 (19%)
Mito_carr 219..307 CDD:278578 24/85 (28%)
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 40/101 (40%)
PTZ00169 358..631 CDD:240302 85/294 (29%)
Mito_carr 449..539 CDD:278578 20/97 (21%)
Mito_carr 544..633 CDD:278578 27/97 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441998
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.