DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and CG5805

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:305 Identity:73/305 - (23%)
Similarity:122/305 - (40%) Gaps:48/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NAIKFL-FGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGI 80
            |..||. ...||.......:.||.::||::|:.....   .|:..:.|...|...||...||:|.
  Fly    38 NKTKFFPLSMLSSFSVRCCLFPLTVIKTQLQVQHKSD---VYKGMVDCAMKIYRSEGVPGLYRGF 99

  Fly    81 ---GAALLRQATYTTGRLGMYTYLNDL---FREKFQRSPGITDSMAMGTIAGACGAFIGTPAEV- 138
               ...::....|.:...|:...||||   .|.|         ::|.|..|...|..|..|.:| 
  Fly   100 WISSVQIVSGVFYISTYEGVRHVLNDLGAGHRMK---------ALAGGGCASLVGQTIIVPFDVI 155

  Fly   139 ---ALV-----RMTSDGRL-PVAER----RNYTNVANALAR-ITREEGLTALWRGSLPTVGRAMV 189
               |:|     ...|.|.: |:..:    |:..:::..:.| |.|.:|....:||...:: .|.|
  Fly   156 SQHAMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASL-MAYV 219

  Fly   190 VNMTQ-LASYSQFK-TYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDG 252
            .|... .|.|..:: ..||..|:.:.. :.:...|..|.|..|||.:.||||.:.|:|..::...
  Fly   220 PNSAMWWAFYHLYQDELFRICPVWVSH-LFIQCVAGSLGGFTTTILTNPLDIVRARLQVHRLDSM 283

  Fly   253 KPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIIL 297
            ...:|       .:.::|.:...:||.:   .||......:|.|:
  Fly   284 SVAFR-------ELWQEEKLNCFFKGLS---ARLVQSAAFSFSII 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 25/98 (26%)
Mito_carr 118..207 CDD:278578 25/105 (24%)
Mito_carr 219..307 CDD:278578 20/79 (25%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 18/81 (22%)
Mito_carr 132..238 CDD:395101 25/115 (22%)
Mito_carr 245..327 CDD:395101 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.