DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and Dic1

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:289 Identity:103/289 - (35%)
Similarity:158/289 - (54%) Gaps:35/289 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGIGAALL 85
            :.||||:.:||.||..||||:|..:|.      ::.:.|....|..:..::|.|..|.|:.|::|
  Fly    10 WFFGGLASVGAAMVTHPLDLIKVTLQT------QQGHLSVAQLIPKLAREQGVLVFYNGLSASVL 68

  Fly    86 RQATYTTGRLGMY----TYLNDLFREKFQRSPGITDS----MAMGTIAGACGAFIGTPAEVALVR 142
            ||.||:|.|.|:|    .|:|             |||    :|:...:|..|..:||||::..||
  Fly    69 RQLTYSTARFGVYEAGKKYVN-------------TDSFGGKVALAGASGLVGGIVGTPADMVNVR 120

  Fly   143 MTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRH 207
            |.:|.:||..:||||.|..:.|.|:.|:||...|:.|:.....|.:::.:.|:|.|.|.|.|...
  Fly   121 MQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLA 185

  Fly   208 GPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKP-EYRGTADVLLRVARQEG 271
            .| ..::.:..||.||:::|.:.|..:.|||:.|||..|     .|| |:.|..|::...|:. |
  Fly   186 TP-YFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMN-----AKPGEFNGLWDIVKHTAKL-G 243

  Fly   272 VFALWKGFTPYYCRLGPHTVLTFIILEQL 300
            ....:||:.|.:.||||||::||:.||||
  Fly   244 PLGFFKGYVPAFVRLGPHTIITFVFLEQL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 32/91 (35%)
Mito_carr 118..207 CDD:278578 33/92 (36%)
Mito_carr 219..307 CDD:278578 35/83 (42%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 33/100 (33%)
PTZ00169 13..273 CDD:240302 102/286 (36%)
Mito_carr 89..184 CDD:278578 36/107 (34%)
Mito_carr 189..278 CDD:278578 35/90 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441895
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.