DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and GC1

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:332 Identity:95/332 - (28%)
Similarity:153/332 - (46%) Gaps:42/332 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SATSVQEAPKKAVATNAI--KFLFGGLSGMGATMVVQPLDLVKTRMQISGAG-SGKKEYRSSLHC 63
            |||.....|:......|:  |.:.||::|:.....|.||||||||:|....| :|::.|.|...|
  Fly     4 SATIATPLPQPQHQQFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDC 68

  Fly    64 IQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPG---ITDSMAMGTIA 125
            .:.....||...:|:|.|..:|    ..|....:....||.||.|.....|   :|..|..|.:|
  Fly    69 FRKTYKAEGYFGMYRGSGVNIL----LITPEKAIKLTANDYFRHKLTTKDGKLPLTSQMVAGGLA 129

  Fly   126 GACGAFIGTPAEVALVRMTSDGRLPVA--------ERRNYTNVANALARITREEGLTALWRGSLP 182
            ||....:.||.|:..::|...||:..|        |:.:.|.:|   :::.:::|:..|::|   
  Fly   130 GAFQIIVTTPMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLA---SQLIKDKGIFGLYKG--- 188

  Fly   183 TVGRAMVVNMT-QLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSM----PLDIAKT 242
             :|...:.::| .:..:..|.|....||.:.:...:..|..|.|:||....|:.    |.|:.||
  Fly   189 -IGATGLRDVTFSIIYFPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKT 252

  Fly   243 RIQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGFTPYYCR---LGP-----HTVLTFIILEQ 299
            |:|.:|..||:.|::|.:|.:.:..:.||..|.:||   ..||   :.|     .||....:.|.
  Fly   253 RLQAIKKADGEKEFKGISDCITKTLKHEGPTAFFKG---GLCRMIVIAPLFGIAQTVYYLGVAEG 314

  Fly   300 LNQGYNK 306
            | .||.|
  Fly   315 L-LGYQK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 31/95 (33%)
Mito_carr 118..207 CDD:278578 22/97 (23%)
Mito_carr 219..307 CDD:278578 33/100 (33%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 27/80 (34%)
Mito_carr 115..213 CDD:278578 24/104 (23%)
Mito_carr 226..307 CDD:278578 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442046
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.