DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and CG16736

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:273 Identity:75/273 - (27%)
Similarity:120/273 - (43%) Gaps:26/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGIGAALLRQATYTTGRL 95
            |.::..|::||:..||.:..    ...|.|::.:..::::.|....|.||.||.||...:|   :
  Fly    13 AQLLSHPMELVRVNMQANVI----HHSRLSINHMFRLMARHGLPGFYYGIVAACLRCTVHT---M 70

  Fly    96 GMYTYLNDLFREKF--QRSPGITDSMAMGTIAGACGAFIGTP-AEVALVRMTSDGRLPVAERRNY 157
            ..||...:|...|:  ...|..| ||.:| |.|..|..:.|| |::|::|. :|......|||||
  Fly    71 STYTLFYNLQD
NKYVLMLQPYNT-SMVLG-ITGFWGGVLATPFAKLAVIRQ-ADLTRGSYERRNY 132

  Fly   158 TNVANALARITREEGLTALWRG----SLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKL 218
            .|....|..:..:.|.|.|:.|    |:.:.  |:.|..|.::........:.|   :::|....
  Fly   133 RNFWRGLKCMYAKGGFTYLFTGWKINSISST--AVAVLYTPISDKVHTVISWFH---RLDEPWLS 192

  Fly   219 HFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGFTPYY 283
            ......|:|.:.|:...|:|...|...|.....|:..|......::|....:|.|..||   |..
  Fly   193 DLITMALTGSIITVIMTPVDALATLTLNESSHYGRTSYPYLYRKIIRKHGYKGFFFGWK---PAL 254

  Fly   284 CRLGPHTVL-TFI 295
            ..|.||||| ||:
  Fly   255 MALIPHTVLATFV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 20/77 (26%)
Mito_carr 118..207 CDD:278578 27/93 (29%)
Mito_carr 219..307 CDD:278578 23/78 (29%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 20/74 (27%)
Mito_carr 187..277 CDD:278578 24/84 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441910
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.