DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and Mpcp2

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:304 Identity:74/304 - (24%)
Similarity:127/304 - (41%) Gaps:50/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GGLSGMGAT-MVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGIGAALLRQ 87
            ||:...|.| ..|.||||||.|:|:..|     :|::.:|..:..|::||...|.:|....||..
  Fly    68 GGILSCGTTHTFVVPLDLVKCRLQVDQA-----KYKNLVHGFKVTVAEEGARGLAKGWFPTLLGY 127

  Fly    88 ATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGT----IAGACGAFIG----TPAEVALVRMT 144
            :.....:.|:|    :||:.|:....|..::....|    .|.|...|..    .|.|.|.|::.
  Fly   128 SAQGLCKFGLY----ELFK
VKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKIQ 188

  Fly   145 SDGRLPVAERRNY-TNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQ-----FKT 203
            :   :|     .| .|...|:.::.:|||:.|.::|.:|...|.:...|.:.|.:.:     :|.
  Fly   189 T---IP-----GYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKY 245

  Fly   204 YFRHGPLQMEEGIKL--HFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRV 266
            ..........:|.:|  .|.|..::|:...:.|.|.|:..:::...|....           :.|
  Fly   246 VVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKGASA-----------ISV 299

  Fly   267 ARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKYVLG 310
            |:..|...:|.|.||....:|..|.|.:.|.:.:     |..||
  Fly   300 AKSLGFSGMWNGLTPRIIMIGTLTALQWFIYDGV-----KVALG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 27/85 (32%)
Mito_carr 118..207 CDD:278578 22/102 (22%)
Mito_carr 219..307 CDD:278578 18/87 (21%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 26/82 (32%)
Mito_carr <175..245 CDD:278578 17/77 (22%)
Mito_carr 260..338 CDD:278578 20/93 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.