DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and slc25a30

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001165746.1 Gene:slc25a30 / 394840 XenbaseID:XB-GENE-995074 Length:291 Species:Xenopus tropicalis


Alignment Length:295 Identity:103/295 - (34%)
Similarity:150/295 - (50%) Gaps:16/295 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKK----EYRSSLHCIQTIVSKEGPLA 75
            |.|...|::|||:.:.|.....|:||.|||:|:.|..:..|    .||..||.|..|..:||..|
 Frog     3 ALNWKPFIYGGLASITAECGTFPIDLTKTRLQVQGQANDAKYKEIRYRGMLHAIVRIWKEEGVKA 67

  Fly    76 LYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVAL 140
            ||.||..|:||||:|.|.::|.|..|..||.: ......:..::..|.::|...:.|..|.:|..
 Frog    68 LYSGIAPAMLRQASYGTIKIGTYQSLKRLFVD-CPEDETLVINVFCGVLSGVVSSCIANPTDVLK 131

  Fly   141 VRMTSDGRLPVAER-RNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTY 204
            :||.:.|.|..... .|:.|       |.::||...||:|...|..||.:|...:|..|...|.:
 Frog   132 IRMQAQGSLIQGGMIGNFIN-------IYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKH 189

  Fly   205 FRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVD--GKPEYRGTADVLLRVA 267
            .....| |.:.:..||.||...||...:.|.|:|:.:||:.|.:.:.  ....|:||.|.||:..
 Frog   190 LILSGL-MGDTVYTHFLASFTCGLAGALASNPVDVVRTRMMNQRSIRNVSNSSYKGTLDCLLQTW 253

  Fly   268 RQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
            :.||.|||:|||.|.:.||||..::.||..|||.:
 Frog   254 KNEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 40/96 (42%)
Mito_carr 118..207 CDD:278578 24/89 (27%)
Mito_carr 219..307 CDD:278578 36/86 (42%)
slc25a30NP_001165746.1 Solcar 1 7..96 37/88 (42%)
PTZ00169 9..289 CDD:240302 101/289 (35%)
Solcar 2 104..189 24/91 (26%)
Solcar 3 198..289 36/91 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.