DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and ucp2

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_989179.1 Gene:ucp2 / 394786 XenbaseID:XB-GENE-1010081 Length:307 Species:Xenopus tropicalis


Alignment Length:297 Identity:94/297 - (31%)
Similarity:142/297 - (47%) Gaps:12/297 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PKKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGS----GKKEYRSSLHCIQTIVSK 70
            |.....|.|:||:..|.:...|.:...|||..|.|:||.|...    ...:|:.....|.|:|..
 Frog     6 PTDIPPTAAVKFVGAGTAACIADLFTFPLDTAKVRLQIQGENKVVNVKAAQYKGVFGTISTMVKT 70

  Fly    71 EGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTP 135
            |||.:||.|:.|.|.||.::.:.|:|:|..:.. |..|.....||...:|.|...||....:..|
 Frog    71 EGPKSLYNGLVAGLQRQMSFASVRIGLYDSVKQ-FYTKGSEHVGIGSRLAAGCTTGAMAVAVAQP 134

  Fly   136 AEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQ 200
            .:|..||..:...  .:..|.|....:|...|.||||:..||:|:.|.:.|..:||.|:|.:|..
 Frog   135 TDVVKVRFQAQAN--SSANRRYKGTMHAYRTIAREEGMRGLWKGTAPNITRNAIVNCTELVTYDI 197

  Fly   201 FKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLR 265
            .|.......: |.:.:..||.::..:|..||:.:.|:|:.|||..|    ..|.:|....:..|.
 Frog   198 IKDSLLKANI-MTDNLPCHFTSAFGAGFCTTVIASPVDVVKTRYMN----SAKGQYASAINCALT 257

  Fly   266 VARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
            :.|:||..|.:|||.|.:.|||...|:.|:..|||.:
 Frog   258 MFRKEGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLKR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 32/96 (33%)
Mito_carr 118..207 CDD:278578 27/88 (31%)
Mito_carr 219..307 CDD:278578 30/84 (36%)
ucp2NP_989179.1 Mito_carr 11..107 CDD:365909 32/96 (33%)
Mito_carr 112..204 CDD:365909 29/93 (31%)
Mito_carr 211..297 CDD:365909 30/88 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.