DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and Bmcp

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:302 Identity:94/302 - (31%)
Similarity:142/302 - (47%) Gaps:29/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQISG----AGSGKKEYRSSLHCIQTIVSKEGPLALYQGIG 81
            |::||::.:.|.....|:|..|||:||.|    ....:..||........|..:||..|||.||.
  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIW 74

  Fly    82 AALLRQATYTTGRLGMYTYLNDLFREK-----FQRSPGITDSMAMGTIAGACGAFIGTPAEVALV 141
            .|:||||||.|.:.|.|..|..|..|:     ...|..:..::.....|||..:.|..|.:|..|
  Fly    75 PAVLRQATYGTIKFGTYYTLKKL
ANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKV 139

  Fly   142 RMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFR 206
            ||...|      :..:..:......|.:.||:..||||..||..||:|:...:|..|...|....
  Fly   140 RMQVHG------KGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLM 198

  Fly   207 HGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVD----------GKPE-YRGTA 260
            :.   ..:.:..||.:|.::.|.:.|.|.|:|:.:||:.|.:.|.          ..|: |.|:.
  Fly   199 N
A---FGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSL 260

  Fly   261 DVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
            |..::..|.||:.||:|||.|.:.|:||..::.||..|||.:
  Fly   261 DCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 35/96 (36%)
Mito_carr 118..207 CDD:278578 25/88 (28%)
Mito_carr 219..307 CDD:278578 33/95 (35%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 33/86 (38%)
Mito_carr <132..199 CDD:278578 21/72 (29%)
Mito_carr 204..303 CDD:278578 33/99 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442068
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.