DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and slc25a14

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_017208245.1 Gene:slc25a14 / 393133 ZFINID:ZDB-GENE-040426-749 Length:335 Species:Danio rerio


Alignment Length:283 Identity:99/283 - (34%)
Similarity:151/283 - (53%) Gaps:9/283 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQISG-AGSGKKEYRSSLHCIQTIVSKEGPLALYQGIGAAL 84
            |::||::.:.|.....|:||.|||:|:.| ....:..||...|.:..|..:||..|||.||..||
Zfish    58 FVYGGMASIVAEFGTFPIDLTKTRLQVQGQTHCMEVRYRGMFHALLRIGREEGVRALYSGISPAL 122

  Fly    85 LRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGRL 149
            ||||:|.|.::|.|..|..||....:....:. ::..|.::|...:.:..|.:|..:||.:.|.|
Zfish   123 LRQASYGTIKIGTYNTLKKLFVSHPEEETMVI-NVFCGVVSGVLSSSLANPTDVLKIRMQAQGSL 186

  Fly   150 PVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQMEE 214
              .:....:|..|    |.:.||...||||.:||..||.:|...:|..|...|.:.....| |.:
Zfish   187 --LQGSMMSNFMN----IYQTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGL-MGD 244

  Fly   215 GIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGF 279
            .:..||.:|...||...:.|.|:|:.:||:.|.:::.|.|.|:||.|.|::..|.||.|||:|||
Zfish   245 TVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNPLYKGTLDGLMQTWRNEGFFALYKGF 309

  Fly   280 TPYYCRLGPHTVLTFIILEQLNQ 302
            .|.:.||||..::.|:..|||.:
Zfish   310 WPNWLRLGPWNIIFFMTFEQLKK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 36/88 (41%)
Mito_carr 118..207 CDD:278578 25/88 (28%)
Mito_carr 219..307 CDD:278578 36/84 (43%)
slc25a14XP_017208245.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D892773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.