DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and CG7514

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:307 Identity:171/307 - (55%)
Similarity:213/307 - (69%) Gaps:12/307 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLA 75
            ||:: ...:.::.|||:||..|.:|||||||||||||| |.:|  ||:||..|:..:...||.||
  Fly     7 KKSI-PGYMMYINGGLAGMLGTCIVQPLDLVKTRMQIS-ATTG--EYKSSFDCLLKVFKNEGILA 67

  Fly    76 LYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVAL 140
            ||.|:.|.|:|||||||.|:|.|....|.:|::|...|.:..||.||.:|||.||..|.||||||
  Fly    68 LYNGLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVAL 132

  Fly   141 VRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYF 205
            :||.||.|||.|||||||.|.||..||.::||:..||:|.:|||||||:|||.|||||||.|..|
  Fly   133 IRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAF 197

  Fly   206 RHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQE 270
            .    :...|:.||..|:|:|||||||.|||||:||||||..|..    ||:||.|||::|::.|
  Fly   198 S----EYFSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTA----EYKGTMDVLMKVSKNE 254

  Fly   271 GVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKYVLGSNKSTGL 317
            |:.:||||||||.||||||||..||.||||.:.|...|||.:..:.:
  Fly   255 GIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYKHIVLGDDSESNI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 48/92 (52%)
Mito_carr 118..207 CDD:278578 59/88 (67%)
Mito_carr 219..307 CDD:278578 55/87 (63%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 165/281 (59%)
Mito_carr 19..90 CDD:278578 45/73 (62%)
Mito_carr 104..201 CDD:278578 60/100 (60%)
Mito_carr 207..284 CDD:278578 52/80 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462505
Domainoid 1 1.000 83 1.000 Domainoid score I2884
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S777
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 1 1.000 - - FOG0004406
OrthoInspector 1 1.000 - - otm2939
orthoMCL 1 0.900 - - OOG6_101430
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2168
1110.700

Return to query results.
Submit another query.