DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and Tpc2

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:333 Identity:78/333 - (23%)
Similarity:132/333 - (39%) Gaps:41/333 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PKKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTR--MQISGAGSGK-KEYRSSLHCIQTIVSKE 71
            |:.:|....::.:.||::|.....:.||||::|.|  ||:....:.| .:||..:|..:::.::|
  Fly     2 PENSVVVQLMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEE 66

  Fly    72 GPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFRE-KFQRSPGITDSMAMGTIAGACGAFIGTP 135
            |...:::|..:..:...:|...:...|..|..:..: .:.|..........|.|||..||....|
  Fly    67 GMRGMFRGHNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQP 131

  Fly   136 AEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRG-------SLPTVGRAMVVNMT 193
            .:|...:|.:   ...:.||:..|....|.::.:.||...|.||       ..|.||...:    
  Fly   132 FDVVRTQMVA---ADPSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFL---- 189

  Fly   194 QLASYSQFKTYFRHGPLQMEEGIKLH----FCASMLSGLLTTITSMPLDIAKTRIQNM------K 248
             ...|..........|.|.:|   :|    |....|||:|..:...|.|:.|.|||.|      |
  Fly   190 -FYKYLNAAVLMAKPPDQRQE---IHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERK 250

  Fly   249 MVDGKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGY--------- 304
            .....||.......:....|:||:...:||..|...:.|..:.:.|.|.:...:.|         
  Fly   251 TFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKRHYIAPMKEAEK 315

  Fly   305 NKYVLGSN 312
            |:..||.:
  Fly   316 NRQKLGKH 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 21/96 (22%)
Mito_carr 118..207 CDD:278578 22/95 (23%)
Mito_carr 219..307 CDD:278578 27/106 (25%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 69/291 (24%)
Mito_carr 23..99 CDD:278578 18/75 (24%)
Mito_carr 108..194 CDD:278578 21/93 (23%)
Mito_carr 216..307 CDD:278578 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.