DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and Mpcp1

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:315 Identity:74/315 - (23%)
Similarity:136/315 - (43%) Gaps:43/315 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSATSVQEAPKKAVATNAIKFLFGGLSGM---GA--TMVVQPLDLVKTRMQISGAGSGKKEYRSS 60
            ::|.:|.|.......:|.. ||..||.|:   |:  |||| ||||||.|:|:..|     :|:|.
  Fly    56 IAAAAVAEGDSCEFGSNHY-FLLCGLGGIISCGSTHTMVV-PLDLVKCRLQVDPA-----KYKSV 113

  Fly    61 LHCIQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGT-- 123
            ....:..:::||...|.:|.....:..:.....:.|:|    ::|::.:..:.|..::....|  
  Fly   114 FTGFRISLAEEGVRGLAKGWAPTFIGYSMQGLCKFGLY----EVFKKVYGDAIGEENAFLYRTGL 174

  Fly   124 --IAGACGAFIGTPAEVALVRMTSDGRLPVAERRNYT-NVANALARITREEGLTALWRGSLPTVG 185
              .|.|...|.   |::||..|.: .::.:.....:. .:..||.::|.:||:||.::|.:|...
  Fly   175 YLAASASAEFF---ADIALAPMEA-AKVKIQTTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWM 235

  Fly   186 RAMVVNMTQLASYSQ-FKTYFRH------GPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTR 243
            |.:...|.:.|.:.: .:..:::      ......|.:.:.|.|..::|:...|.|.|.|...::
  Fly   236 RQIPYTMMKFACFERTLELLYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSK 300

  Fly   244 IQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILE 298
            :...|....           |.||:|.|...||.|..|....:|..|...:.|.:
  Fly   301 LNQAKGASA-----------LDVAKQLGWSGLWGGLVPRIVMIGTLTAAQWFIYD 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 29/97 (30%)
Mito_carr 118..207 CDD:278578 20/94 (21%)
Mito_carr 219..307 CDD:278578 20/80 (25%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 29/99 (29%)
Mito_carr <188..258 CDD:278578 15/70 (21%)
Mito_carr 273..350 CDD:278578 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441819
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.