DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and CG8323

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:299 Identity:80/299 - (26%)
Similarity:151/299 - (50%) Gaps:16/299 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQISG----AGSGKKEYRSSLHCIQTIVSKEGPLALYQGIG 81
            |:.|||:.:|||....|::::|||:|:.|    .|:..:.|:..::...|:...:|...|.:|:.
  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLA 70

  Fly    82 AALLRQATYTTGRLGMYTYLND---LFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRM 143
            .||..|....:.||.:|:...:   :...|.:.|.|:  .:..|.|.|..|.:..:|..:...::
  Fly    71 PALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGM--GLLWGAIGGVVGCYFSSPFFLIKTQL 133

  Fly   144 TSDG--RLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFR 206
            .|..  ::.|..:..:|::.:||.:|....|:..|||||:..:.||.:.:..|:|::.:.|....
  Fly   134 QSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLV 198

  Fly   207 HGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPE---YRGTADVLLRVAR 268
            ...|..:..:. .|.|.:::|.:.::...|.|:..||:.| :.||.:..   |||..|..:::.|
  Fly   199 QYDLVTQPTLN-SFSAGLIAGSIMSVAITPPDVITTRLYN-QGVDAEGRGLLYRGWLDCFVKILR 261

  Fly   269 QEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKY 307
            .|||:.::|||...|.|:.||:.|..:..::|.....||
  Fly   262 SEGVYGMYKGFWANYLRIAPHSTLVLLFFDELVAVRTKY 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 25/94 (27%)
Mito_carr 118..207 CDD:278578 22/90 (24%)
Mito_carr 219..307 CDD:278578 27/90 (30%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 24/80 (30%)
PTZ00169 5..293 CDD:240302 77/290 (27%)
Mito_carr 101..200 CDD:278578 24/100 (24%)
Mito_carr 206..301 CDD:278578 29/97 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.