DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and Slc25a30

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001013205.1 Gene:Slc25a30 / 361074 RGDID:1359702 Length:291 Species:Rattus norvegicus


Alignment Length:299 Identity:101/299 - (33%)
Similarity:155/299 - (51%) Gaps:24/299 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKK----EYRSSLHCIQTIVSKEGPLA 75
            |.|...|::|||:.:.|.....|:||.|||:||.|..:..|    .||..||.:..|..:||..|
  Rat     3 ALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFREIRYRGMLHALMRIGREEGLRA 67

  Fly    76 LYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVAL 140
            ||.||..|:||||:|.|.::|.|..|..|..|: .....:..::..|.::|...:.|..|.:|..
  Rat    68 LYSGIAPAMLRQASYGTIKIGTYQSLKRLAVER-PEDETLLINVVCGILSGVISSAIANPTDVLK 131

  Fly   141 VRMTS-----DGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQ 200
            :||.:     .|.:          :.|.:: |.::||...||:|...|..||.:|...:|..|..
  Rat   132 IRMQAQNSAVQGGM----------IGNFIS-IYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDI 185

  Fly   201 FKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMK-MVDGK-PEYRGTADVL 263
            .|.:.....| |.:.:..||.:|...||:..:.|.|:|:.:||:.|.: :.||: ..|:||.|.|
  Rat   186 TKKHLILSGL-MGDTVSTHFLSSFTCGLVGALASNPVDVVRTRMMNQRDLRDGRCSGYKGTLDCL 249

  Fly   264 LRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
            |:..:.||.|||:|||.|.:.||||..::.|:..|||.:
  Rat   250 LQTWKNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 40/96 (42%)
Mito_carr 118..207 CDD:278578 22/93 (24%)
Mito_carr 219..307 CDD:278578 36/86 (42%)
Slc25a30NP_001013205.1 Solcar 1 7..96 37/88 (42%)
PTZ00169 9..289 CDD:240302 99/293 (34%)
Solcar 2 104..189 22/95 (23%)
Solcar 3 198..289 36/91 (40%)
Mito_carr 199..289 CDD:395101 36/90 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.