DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and Dic3

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:297 Identity:99/297 - (33%)
Similarity:153/297 - (51%) Gaps:37/297 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKK--EYRSSLHCIQTIVSKEGPLALYQGIGA 82
            ::.|||:....|.....|:||:|.::|.......|.  |....:|      .:.|.|..|.||.|
  Fly    11 RWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIH------ERSGILGFYNGISA 69

  Fly    83 ALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDG 147
            :..||.||||.|..:|....|     :..:..::..||:.|.||..|..:|.|.:|..||:.:|.
  Fly    70 SWFRQLTYTTTRFALYEAGKD-----YVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDV 129

  Fly   148 RLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQM 212
            :||..:||||.:|.:.|.||.:|||:::|:||::|.|.||:::.:...|:|.|.|        ||
  Fly   130 KLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVK--------QM 186

  Fly   213 -------EEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKP-EYRGTADVLLRVARQ 269
                   .||:.|||..|.::|.:..:.:.|||:.||...|     .:| |:.|.....|..|:|
  Fly   187 LKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMN-----AQPGEFSGIGGAFLSTAKQ 246

  Fly   270 EGVFALWKGFTPYYCRLGPHTVLTFIILEQ--LNQGY 304
             |..|.:|||.|...|:.|:|::||::.||  :..||
  Fly   247 -GPLAFYKGFIPALIRVSPNTIITFVLYEQARMRFGY 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 27/90 (30%)
Mito_carr 118..207 CDD:278578 36/88 (41%)
Mito_carr 219..307 CDD:278578 31/89 (35%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 94/284 (33%)
Mito_carr 15..91 CDD:278578 26/86 (30%)
Mito_carr 93..187 CDD:278578 37/101 (37%)
Mito_carr 200..281 CDD:278578 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.