DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and MME1

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:310 Identity:82/310 - (26%)
Similarity:132/310 - (42%) Gaps:51/310 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TNAIK-FLFGGLSGMGATMVVQPLDLVKTRMQI--SGAGSGKKEYRSSLHCIQTIVSKEGPLALY 77
            :|.:| |:.||:.||...:|..|||.:|.|:|.  :........|:..:.|.......||....|
  Fly    12 SNPVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFY 76

  Fly    78 QGIGAALLRQ--------ATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGT 134
            :||.|.|:..        |.|..|:....|  :|..|..:   |.|   .|.|.:||.|.|.:..
  Fly    77 RGISAPLVGVTPIYAVDFAVYAAGKRLFQT--DDHIRLTY---PQI---FAAGALAGVCSALVTV 133

  Fly   135 PAE---VALVRMT-SDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQL 195
            |.:   |.|...| |:|.|      .|....:..|::.|:.|:.:|::|:.     |.::..:..
  Fly   134 PTDRIKVLLQTQTVSNGPL------LYNGTIDTAAKLYRQGGIRSLFKGTC-----ACILRDSPT 187

  Fly   196 ASYSQFKTYFRHGPLQMEEGI--KLHFCASMLS----GLLTTITSMPLDIAKTRIQNMKMVDGKP 254
            ..|  |.||.....|..::..  |:...:::||    |::....::|.|:.|:|:|:      .|
  Fly   188 GFY--FVTYEFLQELARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQS------AP 244

  Fly   255 E--YR-GTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLN 301
            |  |: |...|...:...||..||::|..|...|..|.|...|..:|..|
  Fly   245 EGTYKHGIRSVFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVELTN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 29/103 (28%)
Mito_carr 118..207 CDD:278578 24/92 (26%)
Mito_carr 219..307 CDD:278578 25/90 (28%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 27/96 (28%)
Mito_carr 111..205 CDD:278578 28/112 (25%)
Mito_carr 208..297 CDD:278578 26/93 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441745
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.