DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and Ant2

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:189 Identity:49/189 - (25%)
Similarity:79/189 - (41%) Gaps:18/189 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGIGAALLRQA 88
            ||.:|..:...|.|||..:||:.......|.:|:...:.|:..::..:||:.||:|...::....
  Fly   130 GGAAGATSLCFVYPLDFARTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIV 194

  Fly    89 TYTTGRLGMYTYLNDLFREKFQRSPGITD---SMAMGTIAGACGAFIGTPAEVALVRMTSDGRLP 150
            .|.....|.|....|     |..:|..|.   |.|:..:..........|.:....||.....|.
  Fly   195 IYRAAYFGFYDTCRD-----FLPNPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLK 254

  Fly   151 VAERRNYTNVANALARITREEGLTALWRGSLPTV----GRAMVVNMTQLASYSQFKTYF 205
            .:| ..|.|.|:....|.::||:.|.::|:|..:    |.|:|     ||.|.:.|.||
  Fly   255 KSE-MVYKNTAHCWLVIAKQEGIGAFFKGALSNIIRGTGGALV-----LALYDEMKKYF 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 21/84 (25%)
Mito_carr 118..207 CDD:278578 25/92 (27%)
Mito_carr 219..307 CDD:278578
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 46/185 (25%)
Mito_carr 17..111 CDD:278578
Mito_carr 119..215 CDD:278578 22/89 (25%)
Mito_carr 218..307 CDD:278578 23/94 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.