DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and sesB

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:305 Identity:78/305 - (25%)
Similarity:133/305 - (43%) Gaps:52/305 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SATSVQEAPKKAVATNAIK-FLFGGLSGMGATMVVQPLDLVKTRMQ---ISGAGSGKKEYRSSLH 62
            |.||..:..|...|...:| |..||:|...:...|.|::.||..:|   ||...|..|:|:..:.
  Fly     7 SITSQSKMGKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVD 71

  Fly    63 CIQTIVSKEGPLALYQGIGAALLR----QATYTTGRLGMYTYLNDLFREKFQR--SPGI------ 115
            |...|..::|..:.::|..|.::|    ||            ||..|::|:::  ..|:      
  Fly    72 CFIRIPKEQGFSSFWRGNLANVIRYFPTQA------------LNFAFKDKYKQVFLGGVDKNTQF 124

  Fly   116 ----TDSMAMGTIAGACGAFIGTPAEVALVRMTSD-GRLPVAERRNYTNVANALARITREEGLTA 175
                ..::|.|..|||.......|.:.|..|:.:| |:   ..:|.:|.:.|.|.:|.:.:|:..
  Fly   125 WRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADTGK---GGQREFTGLGNCLTKIFKSDGIVG 186

  Fly   176 LWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTT---ITSMPL 237
            |:||...:|...::..    |:|..|....| |.|...:...: :.:..::.::||   |.|.|.
  Fly   187 LYRGFGVSVQGIIIYR----AAYFGFYDTAR-GMLPDPKNTPI-YISWAIAQVVTTVAGIVSYPF 245

  Fly   238 DIAKTRIQNMKMVDGKPE----YRGTADVLLRVARQEGVFALWKG 278
            |..:.|   |.|..|:..    |:.|......:|:|||..|.:||
  Fly   246 DTVRRR---MMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKG 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 26/100 (26%)
Mito_carr 118..207 CDD:278578 23/89 (26%)
Mito_carr 219..307 CDD:278578 19/67 (28%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 28/108 (26%)
PTZ00169 23..312 CDD:240302 73/289 (25%)
Mito_carr 124..220 CDD:278578 26/103 (25%)
Mito_carr 223..312 CDD:278578 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.