DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and CG5254

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:292 Identity:85/292 - (29%)
Similarity:135/292 - (46%) Gaps:22/292 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AIKFLFGGLSGMGATMVVQPLDLVKTRMQI------SGAGSGKKEYRSSLHCIQTIVSKEGPLAL 76
            |.:.|.||.:|.....::||||:||||:||      :.|..|:..|.....|...:...||..:.
  Fly    15 AFQVLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSY 79

  Fly    77 YQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALV 141
            ::||...:|.:......:..::.....||:........:|.|:| |..||...|....|.||..|
  Fly    80 WKGIMPPILAETPKRAIKFLVFEQTKPLFQFGSPTPTPLTFSLA-GLTAGTLEAIAVNPFEVVKV 143

  Fly   142 RMTSDGRLPVAERRNYTNVANALARITREEGL--TALWRGSLPTVGRAMVVNMTQLASYSQFKTY 204
            ...:|     .:::..:..|.|.. |.:::||  :.|.:|...|:||..|.||.....|...|..
  Fly   144 AQQAD-----RQKKMLSTFAVAKG-IIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFYHSVKNV 202

  Fly   205 ---FRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRV 266
               ::...|:....:.:.|    |:|.|....::|.|:||:|||..:.|.|:.:||||...:..|
  Fly   203 VPEYKESHLEFLRKVTIGF----LAGTLACFVNIPFDVAKSRIQGPQPVPGQIKYRGTLSSMGIV 263

  Fly   267 ARQEGVFALWKGFTPYYCRLGPHTVLTFIILE 298
            .|:||..||:||..|...||||...:..::.|
  Fly   264 YREEGFRALYKGLVPKIMRLGPGGAILLLVFE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 26/96 (27%)
Mito_carr 118..207 CDD:278578 26/93 (28%)
Mito_carr 219..307 CDD:278578 31/80 (39%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 25/93 (27%)
PTZ00169 19..301 CDD:240302 84/288 (29%)
Mito_carr 122..207 CDD:278578 25/91 (27%)
Mito_carr 209..305 CDD:278578 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442061
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.