DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and SLC25A34

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_997231.1 Gene:SLC25A34 / 284723 HGNCID:27653 Length:304 Species:Homo sapiens


Alignment Length:294 Identity:87/294 - (29%)
Similarity:147/294 - (50%) Gaps:15/294 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AIKFLFGGLSGMGATMVVQPLDLVKTRMQISG----AGSGKKEYRSSLHCIQTIVSKEGPLALYQ 78
            |:..:.|..:...|.:...||::||||:|:.|    .|:..:.|...:..:..:...:|...|.:
Human     7 AVDLVLGASACCLACVFTNPLEVVKTRLQLQGELQARGTYPRPYHGFIASVAAVARADGLWGLQK 71

  Fly    79 GIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRM 143
            |:.|.||.|......|...|:.   ..:....:.||.|  :..|.:|||.|||:|:||.:...::
Human    72 GLAAGLLYQGLMNGVRFYCYSL---ACQA
GLTQQPGGT--VVAGAVAGALGAFVGSPAYLIKTQL 131

  Fly   144 TSD--GRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFR 206
            .:.  ..:.|..:.|:..|..||..|.|::||..||:|....|.|.||.:..|||:::..|.:.:
Human   132 QAQTVAAVAVGHQHNHQTVLGALETIWRQQGLLGLWQGVGGAVPRVMVGSAAQLATFASAKAWVQ 196

  Fly   207 HGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVD--GKPE-YRGTADVLLRVAR 268
            ......|:...:.....|:|.:...:...|.|:..||:.| :.||  |:.: |.|..|.::::.|
Human   197 K
QQWLPEDSWLVALAGGMISSIAVVVVMTPFDVVSTRLYN-QPVDTAGRGQLYGGLTDCMVKIWR 260

  Fly   269 QEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
            |||..||:||..|.|.||||||:|:.:..::|.:
Human   261 QEGPLALYKGLGPAYLRLGPHTILSMLFWDELRK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 22/94 (23%)
Mito_carr 118..207 CDD:278578 30/90 (33%)
Mito_carr 219..307 CDD:278578 31/87 (36%)
SLC25A34NP_997231.1 Mito_carr 2..91 CDD:278578 21/83 (25%)
Solcar 1 4..97 22/92 (24%)
Solcar 2 101..194 33/94 (35%)
Mito_carr <119..197 CDD:278578 24/77 (31%)
Mito_carr 203..295 CDD:278578 32/93 (34%)
Solcar 3 204..295 31/92 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.