DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and Slc25a10

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_038798.2 Gene:Slc25a10 / 27376 MGIID:1353497 Length:287 Species:Mus musculus


Alignment Length:292 Identity:103/292 - (35%)
Similarity:155/292 - (53%) Gaps:22/292 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGIGA 82
            |.::.||||:..||.....||||:|..:|.    ..:.:.|.:...:| :|..:|.||||.|:.|
Mouse     6 ASRWYFGGLASCGAACCTHPLDLLKVHLQT----QQEVKLRMTGMALQ-VVRTDGFLALYNGLSA 65

  Fly    83 ALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDG 147
            :|.||.||:..|..:|..:.|...:..|......:.:.:|.|:|..|.|:||||::..|||.:|.
Mouse    66 SLCRQMTYSLTRFAIYETMRDYMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPADLVNVRMQNDM 130

  Fly   148 RLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFK-----TYFRH 207
            :||.::||||::..:.|.|:.|||.|..|:.|:.....|..:|.:.||:.|.|.|     |.:  
Mouse   131 KLPPSQRRNYSHALDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGY-- 193

  Fly   208 GPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGV 272
                :.:.|..||.:|.::|...|....|||:.|||:.|     .|.||:|.....:..|:. |.
Mouse   194 ----LSDNIFTHFVSSFIAGGCATFLCQPLDVLKTRLMN-----SKGEYQGVFHCAMETAKL-GP 248

  Fly   273 FALWKGFTPYYCRLGPHTVLTFIILEQLNQGY 304
            .|.:||..|...||.|||||||:.||||.:.:
Mouse   249 QAFFKGLFPAGIRLIPHTVLTFMFLEQLRKHF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 31/90 (34%)
Mito_carr 118..207 CDD:278578 35/93 (38%)
Mito_carr 219..307 CDD:278578 35/86 (41%)
Slc25a10NP_038798.2 Solcar 1 7..87 29/84 (35%)
Mito_carr 12..92 CDD:278578 29/84 (35%)
Mito_carr 94..189 CDD:278578 34/94 (36%)
Solcar 2 100..187 34/86 (40%)
Solcar 3 196..279 36/88 (41%)
Mito_carr 197..283 CDD:278578 36/90 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.