DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and SLC25A30

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_005266378.1 Gene:SLC25A30 / 253512 HGNCID:27371 Length:293 Species:Homo sapiens


Alignment Length:296 Identity:91/296 - (30%)
Similarity:142/296 - (47%) Gaps:33/296 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKK----EYRSSLHCIQTIVSKEGPLA 75
            |.|...|::|||:.:.|.....|:||.|||:||.|..:..|    .||..||.:..|..:||..|
Human     3 ALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKA 67

  Fly    76 LYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVAL 140
            ||.||..|:||||:|.|.::|.|..|..||.|: .....:..::..|.::|...:.|..|.:|..
Human    68 LYSGIAPAMLRQASYGTIKIGTYQSLKRLFIER-PEDETLPINVICGILSGVISSTIANPTDVLK 131

  Fly   141 VRMTSDGR-LPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTY 204
            :||.:... :......|:.|       |.::||...||:|...|..||.:|...:|..|...|.:
Human   132 IRMQAQSNTIQGGMIGNFMN-------IYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKH 189

  Fly   205 FRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMV-DGK-PEYRGTADVLLRV- 266
            .....| |.:.:..||.:|...||...:.|.|:|:.:||:.|.::: ||: ..|.||.|.||:: 
Human   190 LILSGL-MGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCSGYTGTLDCLLQLT 253

  Fly   267 --------ARQEGVFAL--------WKGFTPYYCRL 286
                    |:.:.:.::        .:|||...|.|
Human   254 VLESFSTTAKPQKLISVDAISEEADTRGFTYLSCDL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 41/96 (43%)
Mito_carr 118..207 CDD:278578 22/89 (25%)
Mito_carr 219..307 CDD:278578 25/87 (29%)
SLC25A30XP_005266378.1 Mito_carr 5..100 CDD:278578 40/94 (43%)
Mito_carr 102..191 CDD:278578 22/95 (23%)
Mito_carr 199..>252 CDD:278578 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.