DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and Ucp1

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_033489.1 Gene:Ucp1 / 22227 MGIID:98894 Length:307 Species:Mus musculus


Alignment Length:289 Identity:87/289 - (30%)
Similarity:144/289 - (49%) Gaps:8/289 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAG--SGKKEYRSSLHCIQTIVSKEGPLALYQ 78
            |..:|....|:|...|.::..|||..|.|:||.|.|  |....|:..|..|.|:...||...||.
Mouse    12 TMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYS 76

  Fly    79 GIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRM 143
            |:.|.:.||.::.:.|:|:|..:.:.|....:....:.:.::.|.:.|....|||.|.||..|||
Mouse    77 GLPAGIQRQISFASLRIGLYDSVQEYFSSGRETPASLGNKISAGLMTGGVAVFIGQPTEVVKVRM 141

  Fly   144 TSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHG 208
            .:...|...:.| ||...||...|...|.|:.||:|:.|.:.|.:::|.|:|.:|...|....:.
Mouse   142 QAQSHLHGIKPR-YTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNN 205

  Fly   209 PLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVF 273
            .: :.:.:..|..:::::|..||:.:.|:|:.|||..|  .:.|  :|.......:.:..:||..
Mouse   206 KI-LADDVPCHLLSALVAGFCTTLLASPVDVVKTRFIN--SLPG--QYPSVPSCAMSMYTKEGPT 265

  Fly   274 ALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
            |.:|||...:.|||...|:.|:..|||.:
Mouse   266 AFFKGFVASFLRLGSWNVIMFVCFEQLKK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 31/94 (33%)
Mito_carr 118..207 CDD:278578 30/88 (34%)
Mito_carr 219..307 CDD:278578 26/84 (31%)
Ucp1NP_033489.1 Mito_carr 10..103 CDD:278578 30/90 (33%)
Solcar 1 11..102 30/89 (34%)
PTZ00169 21..297 CDD:240302 85/280 (30%)
Mito_carr 110..206 CDD:278578 30/96 (31%)
Solcar 2 111..201 30/90 (33%)
Solcar 3 210..295 26/89 (29%)
Mito_carr 215..300 CDD:278578 26/84 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.