DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and Slc25a10

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_596909.1 Gene:Slc25a10 / 170943 RGDID:621430 Length:286 Species:Rattus norvegicus


Alignment Length:290 Identity:103/290 - (35%)
Similarity:155/290 - (53%) Gaps:22/290 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGIGAAL 84
            ::.||||:..||.....||||:|..:|.    ..:.:.|.:...:| :|..:|.||||.|:.|:|
  Rat     8 RWYFGGLASCGAACCTHPLDLLKVHLQT----QQEVKLRMTGMALQ-VVRTDGFLALYNGLSASL 67

  Fly    85 LRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGRL 149
            .||.||:..|..:|..:.|...:..|........:.:|.|:|..|.|:||||::..|||.:|.:|
  Rat    68 CRQMTYSLTRFAIYETMRDYMTKDSQGPLPFYSKVLLGGISGLTGGFVGTPADLVNVRMQNDMKL 132

  Fly   150 PVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFK-----TYFRHGP 209
            |:::||||::..:.|.|:.|||||..|:.|:.....|..:|.:.||:.|.|.|     |.:    
  Rat   133 PLSQRRNYSHALDGLYRVAREEGLKKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGY---- 193

  Fly   210 LQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFA 274
              :.:.|..||.:|.::|...|....|||:.|||:.|     .|.||:|.....:..|:. |..|
  Rat   194 --LSDNIFTHFLSSFIAGGCATFLCQPLDVLKTRLMN-----SKGEYQGVFHCAVETAKL-GPQA 250

  Fly   275 LWKGFTPYYCRLGPHTVLTFIILEQLNQGY 304
            .:||..|...||.|||||||:.||||.:.:
  Rat   251 FFKGLVPAGVRLVPHTVLTFMFLEQLRKHF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 30/88 (34%)
Mito_carr 118..207 CDD:278578 36/93 (39%)
Mito_carr 219..307 CDD:278578 35/86 (41%)
Slc25a10NP_596909.1 Mito_carr 12..92 CDD:395101 29/84 (35%)
Mito_carr 94..189 CDD:395101 35/94 (37%)
Mito_carr 197..283 CDD:395101 36/90 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.