DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and SLC25A10

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens


Alignment Length:236 Identity:71/236 - (30%)
Similarity:116/236 - (49%) Gaps:31/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYR-----SSLHCIQTIVSKEG 72
            |......::.||||:..||.....||||:|..:|.      ::|.:     .:|..::|    :|
Human     2 AAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQT------QQEVKLRMTGMALRVVRT----DG 56

  Fly    73 PLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAE 137
            .||||.|:.|:|.||.||:..|..:|..:.|...:..|......:.:.:|:::|..|.|:||||:
Human    57 ILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPAD 121

  Fly   138 VALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFK 202
            :..|||.:|.:||..:||||.:..:.|.|:.|||||..|:.|:.....|..:|.:.||  |.::.
Human   122 LVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQL--YCRWM 184

  Fly   203 TYF--------RHGPLQMEEGIKLHF------CASMLSGLL 229
            .:.        ...|.:::.|:...|      ..:..||||
Human   185 CHVPVPAPGCAEDSPDELQGGVSGRFPLRRGDSEARASGLL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 30/97 (31%)
Mito_carr 118..207 CDD:278578 32/96 (33%)
Mito_carr 219..307 CDD:278578 5/17 (29%)
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:278578 29/89 (33%)
Mito_carr 95..179 CDD:278578 29/83 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.