DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and slc25a10a

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_002661286.1 Gene:slc25a10a / 100332610 ZFINID:ZDB-GENE-131127-11 Length:288 Species:Danio rerio


Alignment Length:285 Identity:100/285 - (35%)
Similarity:144/285 - (50%) Gaps:12/285 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGI 80
            |...::.|||::...|.....||||:|..:|.    ..:.:.|.:...:| :|..:|..|||.|:
Zfish     4 TRVSRWYFGGIASCAAACCTHPLDLIKVHLQT----QQEVKMRMTGMAVQ-VVRSDGVFALYNGL 63

  Fly    81 GAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTS 145
            .|:|.||.:|:..|..:|..:.|....:.|........:.:....|..|.||||||::..|||.:
Zfish    64 SASLCRQMSYSMTRFAIYETVRDQIASQNQGPMPFYQKILLAAFGGFTGGFIGTPADMVNVRMQN 128

  Fly   146 DGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPL 210
            |.:||...||||.:..:.|.|:.:|||:..|:.|:.....|..:|.:.||:.|.|.|.... |..
Zfish   129 DMKLPPVLRRNYAHALDGLLRVLKEEGIRKLFSGASMAASRGALVTVGQLSCYDQAKQLVL-GTG 192

  Fly   211 QMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFAL 275
            .|.:.|..||.||.::|...|:...|:|:.|||:.|     .|.||||....|....:. |..|.
Zfish   193 LMTDNIFTHFVASFIAGGCATVLCQPMDVVKTRLMN-----SKGEYRGLIHCLSDTGKL-GPKAF 251

  Fly   276 WKGFTPYYCRLGPHTVLTFIILEQL 300
            :||..|...||.||||||||.||||
Zfish   252 YKGLVPAGIRLIPHTVLTFIFLEQL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 27/92 (29%)
Mito_carr 118..207 CDD:278578 32/88 (36%)
Mito_carr 219..307 CDD:278578 37/82 (45%)
slc25a10aXP_002661286.1 Mito_carr 12..86 CDD:278578 24/78 (31%)
Mito_carr 94..190 CDD:278578 32/96 (33%)
Mito_carr 195..281 CDD:278578 38/88 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.