DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and TUP1

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_010007.1 Gene:TUP1 / 850445 SGDID:S000000680 Length:713 Species:Saccharomyces cerevisiae


Alignment Length:524 Identity:123/524 - (23%)
Similarity:185/524 - (35%) Gaps:139/524 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLAVNYKTTKGNERLRHFDLLDLDSKTNIEPLADRILLQTLAEAEEEQSPADL------------ 66
            |.|....||...|             |.|:|            .||:.:||.|            
Yeast   252 GSATTATTTTATE-------------TEIKP------------KEEDATPASLHQDHYLVPYNQR 291

  Fly    67 ---EKSPPP-------RPVSGSVARSQNAFSAL-KQALEKLQKKLREPVKKKFYLHKCHNSHILP 120
               .|..||       :.|..::.:..|.:..| ..||         |.:....|||..: |...
Yeast   292 ANHSKPIPPFLLDLDSQSVPDALKKQTNDYYILYNPAL---------PREIDVELHKSLD-HTSV 346

  Fly   121 LTNVSFDRSGERCLTGSYDRTCHVINTQTAQVEHILSG--------------HDNVVFSVGFNFP 171
            :..|.|...||...||     |:    :|.||..:..|              |.|.:        
Yeast   347 VCCVKFSNDGEYLATG-----CN----KTTQVYRVSDGSLVARLSDDSAANNHRNSI-------- 394

  Fly   172 HWLVYLQSGGSGNNLT------TFSIIFSDKIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAA 230
                      :.||.|      |.:...:..|.|.:....|::  |...::|.|....:::|...
Yeast   395 ----------TENNTTTSTDNNTMTTTTTTTITTTAMTSAAEL--AKDVENLNTSSSPSSDLYIR 447

  Fly   231 E--FHPVDGKSIATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAI 293
            .  |.| |||.:||.:.|...||:|:|....:..|..|..::.:..:...|..|::||.|.:..|
Yeast   448 SVCFSP-DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRI 511

  Fly   294 WDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWDT------RKLDQELYLAARHS 352
            ||:|:......|.......:..|....|..||.||||...|:||:      .:||.|......|.
Yeast   512 WDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHK 576

  Fly   353 DEVLDVSFDAAGQLLATCSSDCTARVWRLE-------------GSSELEMLSLMAGHSDEVSKVC 404
            |.|..|.|...||.:.:.|.|.:.::|.|:             |:.|:..:    ||.|.|..|.
Yeast   577 DSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYI----GHKDFVLSVA 637

  Fly   405 FSPSGCMLLTASADNTARLWLTESGQCSQVLAGHEGEVFSCAYSYAG------DAILTASKDNSC 463
            .:.:...:|:.|.|.....|..:||....:|.||...|.|.|.:...      :...|.|.|...
Yeast   638 TTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKA 702

  Fly   464 RFWR 467
            |.|:
Yeast   703 RIWK 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 102/419 (24%)
WD40 repeat 122..158 CDD:293791 10/35 (29%)
WD40 154..467 CDD:238121 86/359 (24%)
WD40 repeat 189..222 CDD:293791 6/32 (19%)
WD40 repeat 228..265 CDD:293791 13/38 (34%)
WD40 repeat 270..306 CDD:293791 9/35 (26%)
WD40 repeat 314..348 CDD:293791 14/39 (36%)
WD40 repeat 355..393 CDD:293791 11/50 (22%)
WD40 repeat 400..436 CDD:293791 8/35 (23%)
WD40 repeat 442..466 CDD:293791 7/29 (24%)
TUP1NP_010007.1 Tup_N 11..88 CDD:400755
WD40 343..706 CDD:238121 97/396 (24%)
WD40 repeat 347..383 CDD:293791 11/44 (25%)
WD40 repeat 394..438 CDD:293791 10/63 (16%)
WD40 repeat 447..483 CDD:293791 13/36 (36%)
WD40 repeat 488..523 CDD:293791 9/34 (26%)
WD40 repeat 530..566 CDD:293791 11/35 (31%)
WD40 repeat 579..627 CDD:293791 11/47 (23%)
WD40 repeat 633..669 CDD:293791 8/35 (23%)
WD40 repeat 675..705 CDD:293791 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.