DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and WDR5b

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_192182.1 Gene:WDR5b / 828189 AraportID:AT4G02730 Length:333 Species:Arabidopsis thaliana


Alignment Length:247 Identity:68/247 - (27%)
Similarity:118/247 - (47%) Gaps:14/247 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 DGKSIATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKS 300
            :..|...|...|:..||  :....|:.|..|.|.:...:|:.||.:|.:.|.|.:..:|...:.|
plant    14 NANSTGNAGTSGNVPIY--KPYRHLKTLEGHTAAISCVKFSNDGNLLASASVDKTMILWSATNYS 76

  Fly   301 LGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQ 365
            |.|:..|||:.:|:..|:.......:.|.|.|.||||.|...:.|.:...|::.|..|:|:....
plant    77 LIHRYEGHSSGISDLAWSSDSHYTCSASDDCTLRIWDARSPYECLKVLRGHTNFVFCVNFNPPSN 141

  Fly   366 LLATCSSDCTARVWRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQ 430
            |:.:.|.|.|.|:|.::....:.|:.   .||..:|.|.|:..|.::::||.|.:.::|..:.|.
plant   142 LIVSGSFDETIRIWEVKTGKCVRMIK---AHSMPISSVHFNRDGSLIVSASHDGSCKIWDAKEGT 203

  Fly   431 CSQVLAGHEGEVFSCA-YSYAGDAILTASKDNSC--------RFWRXYDWYT 473
            |.:.|...:....|.| :|..|..||.|:.|::.        :|.:.|..:|
plant   204 CLKTLIDDKSPAVSFAKFSPNGKFILVATLDSTLKLSNYATGKFLKVYTGHT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 65/238 (27%)
WD40 repeat 122..158 CDD:293791
WD40 154..467 CDD:238121 66/239 (28%)
WD40 repeat 189..222 CDD:293791
WD40 repeat 228..265 CDD:293791 7/28 (25%)
WD40 repeat 270..306 CDD:293791 10/35 (29%)
WD40 repeat 314..348 CDD:293791 10/33 (30%)
WD40 repeat 355..393 CDD:293791 10/37 (27%)
WD40 repeat 400..436 CDD:293791 10/35 (29%)
WD40 repeat 442..466 CDD:293791 8/32 (25%)
WDR5bNP_192182.1 WD40 26..>330 CDD:225201 65/235 (28%)
WD40 35..330 CDD:238121 63/224 (28%)
WD40 repeat 46..83 CDD:293791 10/36 (28%)
WD40 repeat 89..126 CDD:293791 11/36 (31%)
WD40 repeat 131..167 CDD:293791 10/35 (29%)
WD40 repeat 174..209 CDD:293791 10/34 (29%)
WD40 repeat 216..252 CDD:293791 9/35 (26%)
WD40 repeat 260..297 CDD:293791
WD40 repeat 303..329 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.