Sequence 1: | NP_001263071.1 | Gene: | CG7568 / 43482 | FlyBaseID: | FBgn0039673 | Length: | 482 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083963.1 | Gene: | Wdr38 / 76646 | MGIID: | 1923896 | Length: | 303 | Species: | Mus musculus |
Alignment Length: | 264 | Identity: | 79/264 - (29%) |
---|---|---|---|
Similarity: | 131/264 - (49%) | Gaps: | 7/264 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 197 IVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIATASLDGSARIYDVETSHELQ 261
Fly 262 QLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIAT 326
Fly 327 GSLDNTARIWDTRKLDQ--ELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARVWRLEGSSELEM 389
Fly 390 LSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQVLAGHEGEVFSCAYSYAGDAI 454
Fly 455 LTAS 458 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7568 | NP_001263071.1 | WD40 | 93..466 | CDD:225201 | 79/264 (30%) |
WD40 repeat | 122..158 | CDD:293791 | |||
WD40 | 154..467 | CDD:238121 | 79/264 (30%) | ||
WD40 repeat | 189..222 | CDD:293791 | 9/24 (38%) | ||
WD40 repeat | 228..265 | CDD:293791 | 15/36 (42%) | ||
WD40 repeat | 270..306 | CDD:293791 | 11/35 (31%) | ||
WD40 repeat | 314..348 | CDD:293791 | 10/35 (29%) | ||
WD40 repeat | 355..393 | CDD:293791 | 11/37 (30%) | ||
WD40 repeat | 400..436 | CDD:293791 | 10/35 (29%) | ||
WD40 repeat | 442..466 | CDD:293791 | 2/17 (12%) | ||
Wdr38 | NP_083963.1 | WD40 | <18..300 | CDD:225201 | 79/264 (30%) |
WD 1 | 24..63 | 9/21 (43%) | |||
WD40 | 25..300 | CDD:238121 | 79/264 (30%) | ||
WD40 repeat | 31..66 | CDD:293791 | 9/24 (38%) | ||
WD 2 | 66..105 | 16/39 (41%) | |||
WD40 repeat | 72..108 | CDD:293791 | 15/36 (42%) | ||
WD 3 | 108..147 | 11/38 (29%) | |||
WD40 repeat | 113..149 | CDD:293791 | 11/35 (31%) | ||
WD 4 | 150..189 | 12/38 (32%) | |||
WD40 repeat | 156..194 | CDD:293791 | 10/37 (27%) | ||
WD 5 | 195..233 | 12/41 (29%) | |||
WD40 repeat | 200..235 | CDD:293791 | 11/38 (29%) | ||
WD 6 | 236..277 | 12/40 (30%) | |||
WD 7 | 279..303 | 2/21 (10%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D872177at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |