DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and fbxw7

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_009289569.3 Gene:fbxw7 / 564991 ZFINID:ZDB-GENE-090313-79 Length:835 Species:Danio rerio


Alignment Length:369 Identity:90/369 - (24%)
Similarity:161/369 - (43%) Gaps:88/369 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 REPVKKKFYLHKCHNSHILPLTNVSFDRSGERCLTGSYDRTCHVINTQTAQVEHILSGHDNVVFS 165
            |..:|....:.|.|:.|:  :|.:.|  .|.|.::||.|.|..|.:..|.:....|.||...|:|
Zfish   494 RGDLKSPKVVLKGHDDHV--ITCLQF--CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS 554

  Fly   166 VGFNFPHWLVYLQSGGSGNNLTTFSIIFSDKIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAA 230
                                    |.:..:.|::||.|.|.|||:|.:|:.:.|.||||:.:...
Zfish   555 ------------------------SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCM 595

  Fly   231 EFHPVDGKSIATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWD 295
            ..|.   |.:.:.|.|.:.|::|:||...|..|..|.|.|...::  ||:.:::|::|....:||
Zfish   596 HLHE---KRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQY--DGRRVVSGAYDFMVKVWD 655

  Fly   296 VRSKSLGHQLRGHSAELSNCVWN--FSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDV 358
            ..:::..|.|:||    :|.|::  |.|..:.:||||.:.|:||..                   
Zfish   656 PETETCLHTLQGH----TNRVYSLQFDGIHVVSGSLDTSIRVWDVE------------------- 697

  Fly   359 SFDAAGQLLATCSSDCTARVWRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARL 423
                        :.:|               :..:.||....|.:....:  :|::.:||:|.::
Zfish   698 ------------TGNC---------------IHTLTGHQSLTSGMELKDN--ILVSGNADSTVKI 733

  Fly   424 WLTESGQCSQVLAG-HEGEVFSCAYSYAGDAILTASKDNSCRFW 466
            |..::|||.|.|.| |:.:.......:..:.::|:|.|.:.:.|
Zfish   734 WDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLW 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 89/367 (24%)
WD40 repeat 122..158 CDD:293791 11/35 (31%)
WD40 154..467 CDD:238121 75/316 (24%)
WD40 repeat 189..222 CDD:293791 12/32 (38%)
WD40 repeat 228..265 CDD:293791 10/36 (28%)
WD40 repeat 270..306 CDD:293791 8/35 (23%)
WD40 repeat 314..348 CDD:293791 11/35 (31%)
WD40 repeat 355..393 CDD:293791 1/37 (3%)
WD40 repeat 400..436 CDD:293791 10/35 (29%)
WD40 repeat 442..466 CDD:293791 3/23 (13%)
fbxw7XP_009289569.3 F-box-like 408..452 CDD:315592
WD40 503..778 CDD:238121 88/360 (24%)
WD40 repeat 512..547 CDD:293791 11/36 (31%)
WD40 repeat 553..587 CDD:293791 13/57 (23%)
WD40 repeat 592..626 CDD:293791 9/36 (25%)
WD40 repeat 633..666 CDD:293791 7/34 (21%)
WD40 repeat 672..706 CDD:293791 11/79 (14%)
WD40 repeat 714..746 CDD:293791 9/33 (27%)
WD40 repeat 755..777 CDD:293791 3/21 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R947
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.