DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and FBXW7

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001336727.1 Gene:FBXW7 / 55294 HGNCID:16712 Length:707 Species:Homo sapiens


Alignment Length:360 Identity:90/360 - (25%)
Similarity:159/360 - (44%) Gaps:92/360 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 KCHNSHILPLTNVSFDRSGERCLTGSYDRTCHVINTQTAQVEHILSGHDNVVFSVGFNFPHWLVY 176
            |.|:.|:  :|.:.|  .|.|.::||.|.|..|.:..|.:....|.||...|:|           
Human   377 KGHDDHV--ITCLQF--CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----------- 426

  Fly   177 LQSGGSGNNLTTFSIIFSDKIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIA 241
                         |.:..:.|::||.|.|.|||:|.:|:.:.|.||||:.:.....|.   |.:.
Human   427 -------------SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE---KRVV 475

  Fly   242 TASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKSLGHQLR 306
            :.|.|.:.|::|:||...|..|..|.|.|...::  ||:.:::|::|....:||..:::..|.|:
Human   476 SGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQY--DGRRVVSGAYDFMVKVWDPETETCLHTLQ 538

  Fly   307 GHSAELSNCVWN--FSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLAT 369
            ||    :|.|::  |.|..:.:||||.:.|:||..                              
Human   539 GH----TNRVYSLQFDGIHVVSGSLDTSIRVWDVE------------------------------ 569

  Fly   370 CSSDCTARVWRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQV 434
             :.:|               :..:.||....|.:....:  :|::.:||:|.::|..::|||.|.
Human   570 -TGNC---------------IHTLTGHQSLTSGMELKDN--ILVSGNADSTVKIWDIKTGQCLQT 616

  Fly   435 LAG---HEGEVFSCAYSYAGDAILTASKDNSCRFW 466
            |.|   |:..| :| ..:..:.::|:|.|.:.:.|
Human   617 LQGPNKHQSAV-TC-LQFNKNFVITSSDDGTVKLW 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 89/358 (25%)
WD40 repeat 122..158 CDD:293791 11/35 (31%)
WD40 154..467 CDD:238121 77/318 (24%)
WD40 repeat 189..222 CDD:293791 12/32 (38%)
WD40 repeat 228..265 CDD:293791 10/36 (28%)
WD40 repeat 270..306 CDD:293791 8/35 (23%)
WD40 repeat 314..348 CDD:293791 11/35 (31%)
WD40 repeat 355..393 CDD:293791 1/37 (3%)
WD40 repeat 400..436 CDD:293791 10/35 (29%)
WD40 repeat 442..466 CDD:293791 5/23 (22%)
FBXW7NP_001336727.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..151
F-box-like 281..325 CDD:403981
WD40 374..650 CDD:238121 90/360 (25%)
WD 1 378..418 12/43 (28%)
WD40 repeat 384..419 CDD:293791 11/36 (31%)
WD 2 420..456 14/59 (24%)
WD40 repeat 425..459 CDD:293791 13/57 (23%)
WD 3 459..498 12/41 (29%)
WD40 repeat 464..498 CDD:293791 9/36 (25%)
WD 4 500..536 9/37 (24%)
WD40 repeat 505..538 CDD:293791 7/34 (21%)
WD 5 539..578 14/88 (16%)
WD40 repeat 544..578 CDD:293791 11/79 (14%)
WD 6 580..618 11/39 (28%)
WD40 repeat 586..618 CDD:293791 9/33 (27%)
WD 7 622..659 7/30 (23%)
WD40 repeat 627..649 CDD:293791 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R947
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.