DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and wdr38

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001017672.1 Gene:wdr38 / 550366 ZFINID:ZDB-GENE-050417-160 Length:216 Species:Danio rerio


Alignment Length:168 Identity:53/168 - (31%)
Similarity:85/168 - (50%) Gaps:7/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 GTAKVWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIATASLDGSARIY---DVETSHELQQLTH 265
            |...:|..::.:.|.:..|||..:....|.. ||:..|:||.|.|.|.:   .::.:|   .||.
Zfish    44 GKLYLWKTSTAKLLASVSGHTGPVKCCVFSS-DGRLFASASHDCSVRTWCNSSLKCTH---TLTA 104

  Fly   266 HGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLD 330
            |...|....|:.|||.||:|.:|:.|.||.::|.:|..:|:||:|.:.:.|::.....:||||.|
Zfish   105 HRRSVETVSFSPDGQWLLSGGWDNRALIWSIQSGALLEELKGHNAAVQSSVFSSDSQSVATGSWD 169

  Fly   331 NTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLA 368
            ...|:|..|....|..:...|...|..:.|..||.|::
Zfish   170 RAVRVWKLRDRQAEAVVLQGHLGNVACLCFSVAGMLVS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 53/168 (32%)
WD40 repeat 122..158 CDD:293791
WD40 154..467 CDD:238121 53/168 (32%)
WD40 repeat 189..222 CDD:293791 3/17 (18%)
WD40 repeat 228..265 CDD:293791 11/39 (28%)
WD40 repeat 270..306 CDD:293791 14/35 (40%)
WD40 repeat 314..348 CDD:293791 10/33 (30%)
WD40 repeat 355..393 CDD:293791 5/14 (36%)
WD40 repeat 400..436 CDD:293791
WD40 repeat 442..466 CDD:293791
wdr38NP_001017672.1 WD40 <14..>208 CDD:225201 53/168 (32%)
WD40 <15..200 CDD:238121 49/159 (31%)
WD40 repeat 26..62 CDD:293791 3/17 (18%)
WD40 repeat 67..103 CDD:293791 10/39 (26%)
WD40 repeat 110..145 CDD:293791 13/34 (38%)
WD40 repeat 152..188 CDD:293791 10/35 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D872177at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.