DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and Fbxw7

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001171244.1 Gene:Fbxw7 / 50754 MGIID:1354695 Length:710 Species:Mus musculus


Alignment Length:360 Identity:90/360 - (25%)
Similarity:159/360 - (44%) Gaps:92/360 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 KCHNSHILPLTNVSFDRSGERCLTGSYDRTCHVINTQTAQVEHILSGHDNVVFSVGFNFPHWLVY 176
            |.|:.|:  :|.:.|  .|.|.::||.|.|..|.:..|.:....|.||...|:|           
Mouse   380 KGHDDHV--ITCLQF--CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----------- 429

  Fly   177 LQSGGSGNNLTTFSIIFSDKIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIA 241
                         |.:..:.|::||.|.|.|||:|.:|:.:.|.||||:.:.....|.   |.:.
Mouse   430 -------------SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE---KRVV 478

  Fly   242 TASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKSLGHQLR 306
            :.|.|.:.|::|:||...|..|..|.|.|...::  ||:.:::|::|....:||..:::..|.|:
Mouse   479 SGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQY--DGRRVVSGAYDFMVKVWDPETETCLHTLQ 541

  Fly   307 GHSAELSNCVWN--FSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLAT 369
            ||    :|.|::  |.|..:.:||||.:.|:||..                              
Mouse   542 GH----TNRVYSLQFDGIHVVSGSLDTSIRVWDVE------------------------------ 572

  Fly   370 CSSDCTARVWRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQV 434
             :.:|               :..:.||....|.:....:  :|::.:||:|.::|..::|||.|.
Mouse   573 -TGNC---------------IHTLTGHQSLTSGMELKDN--ILVSGNADSTVKIWDIKTGQCLQT 619

  Fly   435 LAG---HEGEVFSCAYSYAGDAILTASKDNSCRFW 466
            |.|   |:..| :| ..:..:.::|:|.|.:.:.|
Mouse   620 LQGPSKHQSAV-TC-LQFNKNFVITSSDDGTVKLW 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 89/358 (25%)
WD40 repeat 122..158 CDD:293791 11/35 (31%)
WD40 154..467 CDD:238121 77/318 (24%)
WD40 repeat 189..222 CDD:293791 12/32 (38%)
WD40 repeat 228..265 CDD:293791 10/36 (28%)
WD40 repeat 270..306 CDD:293791 8/35 (23%)
WD40 repeat 314..348 CDD:293791 11/35 (31%)
WD40 repeat 355..393 CDD:293791 1/37 (3%)
WD40 repeat 400..436 CDD:293791 10/35 (29%)
WD40 repeat 442..466 CDD:293791 5/23 (22%)
Fbxw7NP_001171244.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..158
F-box-like 284..328 CDD:372399
WD40 377..653 CDD:238121 90/360 (25%)
WD 1 381..421 12/43 (28%)
WD40 repeat 387..422 CDD:293791 11/36 (31%)
WD 2 423..459 14/59 (24%)
WD40 repeat 428..462 CDD:293791 13/57 (23%)
WD 3 462..501 12/41 (29%)
WD40 repeat 467..501 CDD:293791 9/36 (25%)
WD 4 503..539 9/37 (24%)
WD40 repeat 508..541 CDD:293791 7/34 (21%)
WD 5 542..581 14/88 (16%)
WD40 repeat 547..581 CDD:293791 11/79 (14%)
WD 6 583..621 11/39 (28%)
WD40 repeat 589..621 CDD:293791 9/33 (27%)
WD 7 625..662 7/30 (23%)
WD40 repeat 630..652 CDD:293791 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R947
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.