DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and CG10931

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster


Alignment Length:249 Identity:73/249 - (29%)
Similarity:126/249 - (50%) Gaps:10/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 GHTAELVAAEFHPVDGKSIATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGS 286
            ||:..:...:|.. :|:::.::|.|...:::|:..:..:|.|..||..|....::..| ::.:.|
  Fly    54 GHSGCVTGLKFSS-NGENLVSSSGDRLLKLWDLSATRCIQSLAGHGDGVNDVAWSAAG-LIASCS 116

  Fly   287 FDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARH 351
            .|.:..:||.|||.....|.|||....:|.:|...:|:|:.|.|.|.|:||.| ..:.|.:...|
  Fly   117 DDMTVRLWDARSKLCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVR-TGKTLKIVHAH 180

  Fly   352 SDEVLDVSFDAAGQLLATCSSDCTARVWRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTAS 416
            .|.:..|.|...|.:..|.|.|...|:|  :.|:...:.:|:...:..|..|.|||:|..:|:::
  Fly   181 QDPITSVDFHRDGNIFVTSSYDGLVRLW--DSSTGHVLKTLVDVDNIPVGYVKFSPNGRYILSST 243

  Fly   417 ADNTARLWLTESGQCSQVLAGHEGEVFSCAYS----YAGDAILTASKDNSCRFW 466
            .:||.|||..:..:|.:...||..| |.|:.|    ..|..|::.|:||:...|
  Fly   244 LNNTLRLWNYKKPKCMRTYRGHLNE-FYCSNSNFSTTGGIWIVSGSEDNTLCIW 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 72/247 (29%)
WD40 repeat 122..158 CDD:293791
WD40 154..467 CDD:238121 73/249 (29%)
WD40 repeat 189..222 CDD:293791 73/249 (29%)
WD40 repeat 228..265 CDD:293791 7/36 (19%)
WD40 repeat 270..306 CDD:293791 9/35 (26%)
WD40 repeat 314..348 CDD:293791 12/33 (36%)
WD40 repeat 355..393 CDD:293791 9/37 (24%)
WD40 repeat 400..436 CDD:293791 13/35 (37%)
WD40 repeat 442..466 CDD:293791 8/27 (30%)
CG10931NP_611261.1 WD40 <48..341 CDD:225201 73/249 (29%)
WD40 49..341 CDD:238121 73/249 (29%)
WD40 repeat 59..96 CDD:293791 7/37 (19%)
WD40 repeat 102..137 CDD:293791 9/35 (26%)
WD40 repeat 142..178 CDD:293791 12/36 (33%)
WD40 repeat 185..220 CDD:293791 9/36 (25%)
WD40 repeat 227..263 CDD:293791 13/35 (37%)
WD40 repeat 271..309 CDD:293791 8/26 (31%)
WD40 repeat 314..340 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442332
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100268
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.