DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and CG10459

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_610513.2 Gene:CG10459 / 36000 FlyBaseID:FBgn0033440 Length:322 Species:Drosophila melanogaster


Alignment Length:332 Identity:66/332 - (19%)
Similarity:119/332 - (35%) Gaps:74/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 GHDNVVFSVGFNFPHWLVYLQSGGSGNNLTTFSIIFSDKIVTGSFDGTAKVWSATSGQSLCTFYG 222
            ||.:.|..:.||..:...|.                   :.:...||.|.:....:|..:.....
  Fly    11 GHSDSVVELSFNRDYDTGYF-------------------LASAGLDGVAALRHGDTGDCITHLRK 56

  Fly   223 HTAELVAAEF-HPVDGKSIATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGS 286
            ||..:.:... |  |.|.:|:...|...|::|.....:|::| .|...|.....|.....||||.
  Fly    57 HTDSVWSVSLSH--DAKILASGGADCKVRVWDALLGKQLKKL-RHTKTVACVDLNPKATRLLTGC 118

  Fly   287 FDHSA--AIWDVR--SKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWDTRK------- 340
            .|..:  |::|:.  .|:...:.||||..:.:.::........:.|.|.|.|:||.|.       
  Fly   119 IDQESPLALFDMEQSEKAPLMEFRGHSRGVRDVIFCLEEHCFLSSSYDRTVRMWDCRTGTRTNSI 183

  Fly   341 -LDQEL-YLAARHSDEVLDVSFDAAGQL-----------------------------LATCSSDC 374
             |...: .|...||.:::.::: |.|.:                             :..|.:: 
  Fly   184 FLPHHVKSLELHHSGDIVTIAY-AGGVIFLDPKSFEVLKHRKLPYKVTAASLSPNKGIYVCGNN- 246

  Fly   375 TARVWRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQVLAGH- 438
            ....::.:..::::....::.....|..:.|||.|.:....|.|.:..||.....|.|.|  || 
  Fly   247 MGYSFKYDYDTDVDRGLYVSQEPSAVLALSFSPDGEVCAIGSQDGSIILWQMNPKQASVV--GHL 309

  Fly   439 ----EGE 441
                :||
  Fly   310 KDEDDGE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 66/332 (20%)
WD40 repeat 122..158 CDD:293791 66/332 (20%)
WD40 154..467 CDD:238121 66/332 (20%)
WD40 repeat 189..222 CDD:293791 4/32 (13%)
WD40 repeat 228..265 CDD:293791 9/37 (24%)
WD40 repeat 270..306 CDD:293791 10/39 (26%)
WD40 repeat 314..348 CDD:293791 8/42 (19%)
WD40 repeat 355..393 CDD:293791 3/66 (5%)
WD40 repeat 400..436 CDD:293791 12/35 (34%)
WD40 repeat 442..466 CDD:293791 66/332 (20%)
CG10459NP_610513.2 WD40 <10..322 CDD:225201 66/332 (20%)
WD40 11..297 CDD:295369 58/309 (19%)
WD40 repeat 61..97 CDD:293791 9/38 (24%)
WD40 repeat 103..143 CDD:293791 9/39 (23%)
WD40 repeat 148..185 CDD:293791 7/36 (19%)
WD40 repeat 190..222 CDD:293791 5/32 (16%)
WD40 repeat 229..264 CDD:293791 1/35 (3%)
WD40 repeat 272..298 CDD:293791 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44156
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.