DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and DCAF4L1

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001025126.2 Gene:DCAF4L1 / 285429 HGNCID:27723 Length:396 Species:Homo sapiens


Alignment Length:322 Identity:65/322 - (20%)
Similarity:99/322 - (30%) Gaps:121/322 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 NSHILPLTNVSFDRSGERCLTGSYDR-TCHVINTQTAQVEHILSGHDNVVFSVGFNFPHWLVYLQ 178
            :||:|            .|..|..|. :|.|:    ......||.|..|      |.|..|...|
Human   139 DSHVL------------LCFEGITDAPSCAVL----LPASRFLSVHTRV------NQPGMLCSFQ 181

  Fly   179 ---SGGSGNNLTT-----FSIIFSDKIV-----TG---SFDGTAKVWSATSGQSLCTFYGHTAEL 227
               :.....:|.|     ||...|.:::     ||   |||        ||...|...:..||.|
Human   182 IPEAWSCAWSLNTRAYHCFSAGLSQQVLLTSVATGHQQSFD--------TSSDVLAQQFASTAPL 238

  Fly   228 V-----AAEFHPVD------GKSIATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQM 281
            :     :.|...:|      ||......|                   .|.:.|.:.:..::.|.
Human   239 LFNGCRSGEIFAIDLRCRNRGKGWRATRL-------------------FHDSAVTSVQILQEEQC 284

  Fly   282 LLTGSFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELY 346
            |:.........:||:|:.....|..||                                :::..|
Human   285 LMASDMTGKIKLWDLRATKCVRQYEGH--------------------------------VNESAY 317

  Fly   347 LAAR-HSDEVLDVSFDAAGQLLATCSSDCTARVWRLEGSSELEML-SLMAGHSDEVSKVCFS 406
            |... |.:|.:.|   |.||       ||..|:|.|..:..|..: |..:...|::..|.|:
Human   318 LPLHVHEEEGIVV---AVGQ-------DCYTRIWSLHDAHLLRTIPSPYSASEDDIPSVAFA 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 65/322 (20%)
WD40 repeat 122..158 CDD:293791 6/36 (17%)
WD40 154..467 CDD:238121 57/282 (20%)
WD40 repeat 189..222 CDD:293791 11/40 (28%)
WD40 repeat 228..265 CDD:293791 5/47 (11%)
WD40 repeat 270..306 CDD:293791 7/35 (20%)
WD40 repeat 314..348 CDD:293791 1/33 (3%)
WD40 repeat 355..393 CDD:293791 11/38 (29%)
WD40 repeat 400..436 CDD:293791 2/7 (29%)
WD40 repeat 442..466 CDD:293791
DCAF4L1NP_001025126.2 WD40 repeat 185..220 CDD:293791 7/34 (21%)
WD40 <210..368 CDD:330360 43/226 (19%)
WD40 repeat 228..263 CDD:293791 8/34 (24%)
WD 1 268..307 7/38 (18%)
WD40 repeat 273..309 CDD:293791 7/35 (20%)
WD 2 312..351 14/48 (29%)
WD40 repeat 317..353 CDD:293791 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.